DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Tmprss13

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006510195.1 Gene:Tmprss13 / 214531 MGIID:2682935 Length:561 Species:Mus musculus


Alignment Length:435 Identity:111/435 - (25%)
Similarity:176/435 - (40%) Gaps:82/435 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 IRYRVDFPIPTIPPKITSMQLNGVQLCSGGVYPKPRTGITLRITWTPSYISVF-GVNPQPVPTRP 158
            |:|:.  |:.:.|  |.:::.:||..|.   ......| .:|..|..|.:.|: |.:.:.:|. .
Mouse   189 IKYKE--PLESCP--IHAVRCDGVVDCK---MKSDELG-CVRFDWDKSLLKVYSGSSGEWLPV-C 244

  Fly   159 RPAWQDESPQIDYRETRPSQPRLEDSGELFGRSNESLPAFQNPGWGTAPQQAN-PNRGITSQPEI 222
            ..:|.|                           .:|....|..|:.:|.:... .:|.|||...:
Mouse   245 SSSWND---------------------------TDSKRTCQQLGFDSAYRTTEVAHRDITSSFLL 282

  Fly   223 PSPVPQRPTPNPSRSNAPQQAVRSPVDLVPQQNPSSNGIP-----CGRERASTTPLIFQGKSLQR 282
                        |..|...|.     .|...|.||...:.     ||. ||.|..:: .|.....
Mouse   283 ------------SEYNTTIQE-----SLYRSQCPSRRYVSLQCSHCGL-RAMTGRIV-GGALTSE 328

  Fly   283 GQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSD 347
            .:.||.|::     ..|...|||||||....||:|||||... |:.......|..|.:.|  |..
Mouse   329 SKWPWQVSL-----HFGTTHICGGTLIDAQWVLTAAHCFFVT-REKLLEGWKVYAGTSNL--HQL 385

  Fly   348 GEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGW 412
            .|...:||:||:.|:..:| .:.|:||:||.:|:..:.:|.|.||........|.:  ..::.|:
Mouse   386 PEAASISQIIINGNYTDEQ-DDYDIALIRLSKPLTLSAHIHPACLPMHGQTFGLNE--TCWITGF 447

  Fly   413 G-PDETGTGNTEVSKVTDLNIVSEANCALELPH-VLVQPSSLCA--KKTGAGPCASDGGGPLMLR 473
            | ..||....:...:...:|::....|...|.: ..:.|..:||  .:.|...|..|.||||:..
Mouse   448 GKTKETDEKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCE 512

  Fly   474 EQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVRQKM 518
            :.:.|.|.||.|.|....::|     ||.|:|.|.:.:.|:.:||
Mouse   513 QNNRWYLAGVTSWGTGCGQKN-----KPGVYTKVTEVLPWIYRKM 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649 8/30 (27%)
Tryp_SPc 277..517 CDD:238113 72/243 (30%)
Tryp_SPc 277..514 CDD:214473 71/240 (30%)
Tmprss13XP_006510195.1 PHA03378 <6..>122 CDD:223065
LDLa <204..220 CDD:238060 4/19 (21%)
SRCR_2 225..314 CDD:373897 24/134 (18%)
Tryp_SPc 319..548 CDD:214473 71/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.