| Sequence 1: | NP_650344.2 | Gene: | CG31326 / 41728 | FlyBaseID: | FBgn0051326 | Length: | 520 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_034298.1 | Gene: | F2 / 14061 | MGIID: | 88380 | Length: | 618 | Species: | Mus musculus |
| Alignment Length: | 570 | Identity: | 126/570 - (22%) |
|---|---|---|---|
| Similarity: | 199/570 - (34%) | Gaps: | 168/570 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 YIGLVEVRH---------------PEANNQTLILQFSQQGYHDFEDYVGSISLVDDDEVTQENLR 90
Fly 91 QGLPIRYRVDFPIPTIPPKITSMQLNGVQLCSGGVYPKPRTG-------------ITLRITWTPS 142
Fly 143 YISVFGVNPQPVPTRPRPA-----WQDESPQIDYRETRPSQPRLEDSG----------------- 185
Fly 186 ----ELFGRSN----ESLP---------AFQNP---GWGTAPQQANPNRGITSQPEIPSPVPQRP 230
Fly 231 TPNPSRSNAPQQAVRSPVDLVPQQNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAIFERR 295
Fly 296 ESNGPAFICGGTLISTSTVLSAAHCFRAP--GRDLPASRLAVSLGRNTLAIHSDGEF-RGV---- 353
Fly 354 --SQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQ-GLKSYVAGWGP- 414
Fly 415 DETGTGN-----TEVSKVTDLNIVSEANCALELPHVLVQPSSLCA------KKTGAGPCASDGGG 468
Fly 469 PLMLRE--QDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVRQ 516 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31326 | NP_650344.2 | GD_N | 26..126 | CDD:292649 | 21/99 (21%) |
| Tryp_SPc | 277..517 | CDD:238113 | 73/264 (28%) | ||
| Tryp_SPc | 277..514 | CDD:214473 | 72/260 (28%) | ||
| F2 | NP_034298.1 | GLA | 25..89 | CDD:214503 | |
| KR | 107..189 | CDD:214527 | 20/92 (22%) | ||
| KR | 213..295 | CDD:214527 | 12/81 (15%) | ||
| Thrombin_light | 313..360 | CDD:286482 | 8/76 (11%) | ||
| Tryp_SPc | 360..610 | CDD:214473 | 74/272 (27%) | ||
| Tryp_SPc | 361..613 | CDD:238113 | 74/267 (28%) | ||
| High affinity receptor-binding region which is also known as the TP508 peptide. /evidence=ECO:0000250 | 548..570 | 8/22 (36%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||