DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and AgaP_AGAP008891

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_319638.4 Gene:AgaP_AGAP008891 / 1279859 VectorBaseID:AGAP008891 Length:395 Species:Anopheles gambiae


Alignment Length:296 Identity:77/296 - (26%)
Similarity:127/296 - (42%) Gaps:42/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 RSPVDLVP--------QQNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPA 301
            |.|:...|        |:.|::...|      ...|.:..|:...:|:.|.:.||...|......
Mosquito    26 RPPLQYTPGNSLDECEQRFPNNQYEP------EIVPAVSGGRRAFQGEFPHMAAIGWTRTDAPVD 84

  Fly   302 FICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFR---GVSQLIIHENFQ 363
            ::|||:||:...||:|||| .|...::|..  .|.|....||..||.||.   .::::|.|..::
Mosquito    85 YLCGGSLITWKFVLTAAHC-SADLDNIPPD--TVRLADTDLASTSDDEFAQQIPIARIIKHPQYR 146

  Fly   364 FKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVT 428
            :.: ...|:|:|.|:|.|:....|...|||...|   :|..|...| |:|....|...:...:..
Mosquito   147 WSR-KYYDIAVVELEEYVKPNKVICVACLWREPN---VPGDLMDAV-GFGALGFGERLSSTLQKI 206

  Fly   429 DLNIVSEANCALELPHVL------VQPSSLCAKKTGAGPCASDGGGPLMLREQDVW-----VLRG 482
            .|..:.|..||..||.:.      ::...|||.......|..|.||||.....|:.     ::.|
Mosquito   207 KLQALDETICAKRLPAMRREMPEGLRDDQLCAHSATMDTCEGDSGGPLQTDRTDLLGKTYALIVG 271

  Fly   483 VISGGVINEKENTCELSKPSVFTDVAKHIEWVRQKM 518
            |::.|      ..|......|:|.|:.:::|:.:::
Mosquito   272 VVAFG------TPCTNGSTGVYTRVSSYLDWIEEEV 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 70/253 (28%)
Tryp_SPc 277..514 CDD:214473 69/250 (28%)
AgaP_AGAP008891XP_319638.4 Tryp_SPc 57..297 CDD:214473 69/253 (27%)
Tryp_SPc 59..299 CDD:238113 70/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.