DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG43179

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001247094.1 Gene:CG43179 / 12797902 FlyBaseID:FBgn0262808 Length:152 Species:Drosophila melanogaster


Alignment Length:130 Identity:37/130 - (28%)
Similarity:61/130 - (46%) Gaps:8/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLASLINLVLGQLPRNGCSGRFQYQGYQGQ--YIGLVEVRHPEANNQTLILQFSQQGYHDFEDYV 73
            |.|..|:::...||.:.|...|.|:..:.:  |||:.........:.....:||.:|..|..|| 
  Fly     9 LYACFISVLAVYLPEHNCHSYFTYETMELEKTYIGVFTAHKSLLTSFYWEAEFSARGSIDQVDY- 72

  Fly    74 GSISLVDDDEVTQENLRQGLPIRYRVDFP-IPTIPPKITSMQLNGVQLCSGGVYPKPRTGITLRI 137
              ::...|::...:|:::|...:..|.|. |.:..||:.|.:|||..|||...||.  ..||.|:
  Fly    73 --LNPYPDNQECFKNIKRGNRAQMFVSFQNITSELPKLISFKLNGETLCSNEKYPP--LSITTRV 133

  Fly   138  137
              Fly   134  133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649 27/102 (26%)
Tryp_SPc 277..517 CDD:238113
Tryp_SPc 277..514 CDD:214473
CG43179NP_001247094.1 GD_N 24..124 CDD:292649 27/102 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.