DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and AgaP_AGAP004770

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_318046.3 Gene:AgaP_AGAP004770 / 1278456 VectorBaseID:AGAP004770 Length:259 Species:Anopheles gambiae


Alignment Length:261 Identity:65/261 - (24%)
Similarity:110/261 - (42%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 TTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLA 334
            ||..|..|..:..|..|:..::    :|:| ..:|||::|....||||.||         :|:..
Mosquito    27 TTQRIVGGHEIDIGAAPFQASV----QSHG-VHVCGGSIIHQQWVLSAGHC---------SSKEP 77

  Fly   335 VSLGRNTLAIHSD--GEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSN 397
            .||.....:||.:  |:...|.:.|.|..:..:...:.|::|:||::           ||..:.|
Mosquito    78 NSLSVRVASIHHNQGGQIVNVEESIRHPLYDEQLIIDYDVSLLRLEQ-----------CLTFSPN 131

  Fly   398 --RMDLP-------QGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANC--ALELPHVLVQPSS 451
              .:.||       .|....|:|||..:....:::..:.||:.:|:.|.|  |.......:....
Mosquito   132 VQAIRLPMQDEFFQDGTVCVVSGWGATQNPVESSDRLRATDVPLVNHAVCQTAYISAAATITDRM 196

  Fly   452 LCAK--KTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTC-ELSKPSVFTDVAKHIEW 513
            :||.  ..|...|..|.||||......:         ||::.:...| |::.|.|::.||....|
Mosquito   197 ICAGYFSGGRDACQGDSGGPLYYENTLI---------GVVSWRTGDCAEVNFPGVYSRVASVRAW 252

  Fly   514 V 514
            :
Mosquito   253 I 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 62/254 (24%)
Tryp_SPc 277..514 CDD:214473 61/252 (24%)
AgaP_AGAP004770XP_318046.3 Tryp_SPc 30..253 CDD:214473 62/256 (24%)
Tryp_SPc 31..256 CDD:238113 63/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.