DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and F11

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_082342.1 Gene:F11 / 109821 MGIID:99481 Length:624 Species:Mus musculus


Alignment Length:409 Identity:110/409 - (26%)
Similarity:168/409 - (41%) Gaps:85/409 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 AWQDESPQ----IDYRETRPSQPRLEDSGELFGRS----NESLPAFQNPGWGTAPQQANPNRGIT 217
            ||..||.:    :...|:.....|:..|..|.|.|    ..|:|.|.:|.:      .|....:.
Mouse   245 AWPKESQRHLCLLKTSESGLPSTRITKSHALSGFSLQHCRHSVPVFCHPSF------YNDTDFLG 303

  Fly   218 SQPEIPSPVPQRPTPNPSRSNA--------PQQAVRSPVDLVPQQNP--------SSNGIP---- 262
            .:.:|.....|........:||        |...      |..::|.        ||||.|    
Mouse   304 EELDIVDVKGQETCQKTCTNNARCQFFTYYPSHR------LCNERNRRGRCYLKLSSNGSPTRIL 362

  Fly   263 -------------CGRERASTT---PLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLIST 311
                         |..:...||   |.:..|.:...|:.||.|.:   ..|.|  .:|||::|..
Mouse   363 HGRGGISGYSLRLCKMDNVCTTKINPRVVGGAASVHGEWPWQVTL---HISQG--HLCGGSIIGN 422

  Fly   312 STVLSAAHCFRAPGRDLPASRLAVSLG-RNTLAIHSDGEFRGVSQLIIHENFQFKQFTEA----D 371
            ..:|:|||||  .|.:.| .:|.|..| .|...|:....|..|.::|||:     |:|.|    |
Mouse   423 QWILTAAHCF--SGIETP-KKLRVYGGIVNQSEINEGTAFFRVQEMIIHD-----QYTTAESGYD 479

  Fly   372 LALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDE-TGTGNTEVSKVTDLNIVSE 435
            :||::|:..:.|||:..||||.|..:|..:  ..:.:|.|||... .|...:.:.| ..:.:||.
Mouse   480 IALLKLESAMNYTDFQRPICLPSKGDRNAV--HTECWVTGWGYTALRGEVQSTLQK-AKVPLVSN 541

  Fly   436 ANCALELPHVLVQPSSLCA--KKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCEL 498
            ..|........:....:||  |:.|...|..|.||||..:...||.|.|:.|.|     |...:.
Mouse   542 EECQTRYRRHKITNKMICAGYKEGGKDTCKGDSGGPLSCKYNGVWHLVGITSWG-----EGCGQK 601

  Fly   499 SKPSVFTDVAKHIEWVRQK 517
            .:|.|:|:|||:::|:.:|
Mouse   602 ERPGVYTNVAKYVDWILEK 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 78/247 (32%)
Tryp_SPc 277..514 CDD:214473 77/244 (32%)
F11NP_082342.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519 10/37 (27%)
APPLE 291..376 CDD:128519 14/96 (15%)
Tryp_SPc 389..617 CDD:214473 77/248 (31%)
Tryp_SPc 390..617 CDD:238113 77/247 (31%)
Heparin-binding. /evidence=ECO:0000250 547..550 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.