DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abi and ABIL2

DIOPT Version :10

Sequence 1:NP_001247091.1 Gene:Abi / 41718 FlyBaseID:FBgn0020510 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_190498.1 Gene:ABIL2 / 824090 AraportID:AT3G49290 Length:312 Species:Arabidopsis thaliana


Alignment Length:68 Identity:13/68 - (19%)
Similarity:23/68 - (33%) Gaps:14/68 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 WYEHRLIDDQVAQAL---------KSSGGFVWACKNYDGDVQSDIVAQGYG-----SLGLMSSVL 317
            |.:.|||.|::..:.         ...|..:.....|:..:|.|.:...|.     .:|:.....
plant   123 WGKERLIGDKLVSSYFLLGAGTNPHLQGELIEESNTYNDIIQRDFIDTYYNLTLKTIMGVEWICT 187

  Fly   318 MCP 320
            .||
plant   188 YCP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AbiNP_001247091.1 Abi_HHR 105..168 CDD:462279
SH3_Abi 423..474 CDD:212760
ABIL2NP_190498.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.