DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abi and ABIL1

DIOPT Version :10

Sequence 1:NP_001247091.1 Gene:Abi / 41718 FlyBaseID:FBgn0020510 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001118534.1 Gene:ABIL1 / 819230 AraportID:AT2G46225 Length:329 Species:Arabidopsis thaliana


Alignment Length:190 Identity:37/190 - (19%)
Similarity:64/190 - (33%) Gaps:48/190 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LVPGWTQPITIGRHAFGDQYKCTDLV--IPSGSTLQL-LVNKPDGSKDVHNVYDFKKSGGVGLAM 204
            :|..|.:...:|| .:..|....|:.  :|.|:...| .:|..:.|:.|..|   :...|.|:.:
plant   219 VVAYWEEKTRVGR-LYSVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKV---RSKIGYGIQL 279

  Fly   205 YNTDESIKGFAHSCFQYALMKQWPLYLSTKNTILKKYDGR---FKDIFQDI------YEKKYEAD 260
            ....:.:..:..|        .:|:::  |:..|...|.|   ...:|...      |||.|...
plant   280 TKEVDGVWVYNRS--------SYPIFI--KSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQ 334

  Fly   261 FKNNKIWYEHRLIDDQVAQALKSSGGFVWACKNYDGDVQSDIVAQGYGSLGLMSSVLMCP 320
            ..|     :|..:.....       ||.         ||...| :|:|.......:..||
plant   335 RPN-----DHEFMQQPWT-------GFT---------VQISFV-KGWGQCYTRQFISSCP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AbiNP_001247091.1 Abi_HHR 105..168 CDD:462279 6/24 (25%)
SH3_Abi 423..474 CDD:212760
ABIL1NP_001118534.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.