DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif19A and KIF6

DIOPT Version :8

Sequence 1:NP_996208.1 Gene:Kif19A / 41717 FlyBaseID:FBgn0038205 Length:750 Species:Drosophila melanogaster
Sequence 2:XP_005248961.1 Gene:KIF6 / 221458 HGNCID:21202 Length:842 Species:Homo sapiens

Alignment Length:773 Identity:188/774 (24%)
Similarity:317/774 (41%) Gaps:168/774 (22%)


  Fly    33 EERLVVAVRVRP----------SMEATERCI---EVISGGSLLYDDG---GKSRPRQYSYDHVFR 81
            ::.:.:..||:|          |::..|:.|   |:|....|.  ||   .|....::.:..:|.
Human     3 KQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLA--DGFVNNKRESYKFKFQRIFD 65

  Fly    82 ENDSQEQVYKTTTAPLVRDVLNGLNAAVFAYGATGSGKTHTMLGPVPRKKPQTSDRAPPTASCDS 146
            ::.:||.|::....|:...||.|.|..:||||.||||||.|:.|...|    .|||         
Human    66 QDANQETVFENIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAER----YSDR--------- 117

  Fly   147 TDVSSQDIGLMVRAIEDIFSHIESAEAYSCRVSISYLEIYNELIRDLLNPGGPLELRED------ 205
                    |::.|.:..||..::...:......|||||||||...|||:|.......||      
Human   118 --------GIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHEASSLEDLPKVTI 174

  Fly   206 --HRGQRITVAGLSEITTSSRKEVVSLLLKGNKARTMEPTAANQTSSRSHALLSIMVQARTP--L 266
              ...|.|.:..|:....::.:|.::||..|:..|.:..|..||.|:|||.:.:|.:.::.|  .
Human   175 LEDPDQNIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSA 239

  Fly   267 GTKQGRLFLTDLAGSERAKKTKNRGKRLQEGAHINRSLLALGNVINGLSGGAR-YVNYRDSKLTR 330
            ..:..:|.|.|||||||..||...|..|.|..:||.||..|..||..||...| ::.||:|.:|.
Human   240 TVRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSEKHRSHIPYRNSMMTS 304

  Fly   331 LLKEALSGRCKTVMIAHVAPESKHRDETKNTLVYADRANSITTKLQNSVYIDEFKD--FPTKHYQ 393
            :|:::|.|.|.|.|||.::.|.::.||:.:|..:|.|    ...::|...::|..:  ...|..|
Human   305 VLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQR----VALIKNEAVLNEEINPRLVIKRLQ 365

  Fly   394 SLVSELRDEVSRL----RTKMLTE---------------------RPRSGAAAAAAAAAASG--- 430
            ..:.||:||::.:    ||:.|||                     |...||...........   
Human   366 KEIQELKDELAMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRKVHHCFHHLKK 430

  Fly   431 --------SAGTAGSGAGSEAVQE---QDEQRK-TELRYLREQIVLTFKQQMKLRRKLLEAESHL 483
                    ...|..|.:..:..||   ::|.|| .::...|:..:......:|..:|..:...||
Human   431 LLNDKKILENNTVSSESKDQDCQEPLKEEEYRKLRDILKQRDNEINILVNMLKKEKKKAQEALHL 495

  Fly   484 LGLEL---------------DAERQHMIISHWQGR------IGK----LYDAMGDDDIESEGSVA 523
            .|::.               ..|.|.|.:|....:      :||    |:..:|   :..|.|:.
Human   496 AGMDRREFRQSQSPPFRLGNPEEGQRMRLSSAPSQAQDFSILGKRSSLLHKKIG---MREEMSLG 557

  Fly   524 LKNAW-------GELAAIEKE----TRRYKEIRERTEHELEQCRQKGVKLEDELPER-------- 569
            .:.|:       .:...|:..    .:|:.|.:...| .:.:.|.|...|::|:.:|        
Human   558 CQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGE-SINEARSKIGHLKEEITQRHIQQVALG 621

  Fly   570 ISSDEERELLALLCRVHELEADKVSLQAERLARQAELRRRDLQLLRAERQRRLCEDIISSQRRLI 634
            ||.:....|:.      :.:.:|:..|.|...|:.:.....|:.|:.|         |...:.|:
Human   622 ISENMAVPLMP------DQQEEKLRSQLEEEKRRYKTMFTRLKALKVE---------IEHLQLLM 671

  Fly   635 EEGNVDLPDELRELYGLYQQEIHAGVVTPSTSNYERKLPPIYTAGSDSPGSSSSSEWS 692
            ::..|.|..|....:.  ::..:..|.:|:.::.:...|.:.|       |.|..|||
Human   672 DKAKVKLQKEFEVWWA--EEATNLQVNSPAVNSLDHTKPFLQT-------SDSQHEWS 720

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Kif19ANP_996208.1 Motor_domain 35..371 CDD:277568 115/363 (32%)
Kinesin 41..371 CDD:278646 115/357 (32%)
KIF6XP_005248961.1 Motor_domain 5..343 CDD:277568 115/365 (32%)
Kinesin 11..345 CDD:278646 115/361 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.