DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and AT1G45015

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_683380.1 Gene:AT1G45015 AraportID:AT1G45015 Length:153 Species:Arabidopsis thaliana

Alignment Length:44 Identity:9/45 (20%)
Similarity:16/45 (36%) Gaps:12/45 (27%)


  Fly    85 LPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSFKILP 128
            :||..|.....|.            ||:.:|..:.:..|..::|
plant    80 IPFKYYDFCQLCK------------CPMLSGTNFVFTLSQILIP 111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 9/45 (20%)
AT1G45015NP_683380.1 ML 27..140 CDD:294195 9/45 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11306
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.