DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and AT3G11780

DIOPT Version :10

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001189862.1 Gene:AT3G11780 / 820352 AraportID:AT3G11780 Length:171 Species:Arabidopsis thaliana


Alignment Length:134 Identity:27/134 - (20%)
Similarity:59/134 - (44%) Gaps:28/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSLGLFVIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPER 67
            |::..|::.:.::   ::|||..|..::...:....|.|:..|     :.|...|:.::....: 
plant    10 LAISYFLLVSTIV---AATDVHYCDNNEEYEVKVQGVDITPYP-----IARGEPATFRISANTD- 65

  Fly    68 DFQELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGE--KKVGCPLKAGQVYTYKNSFKILPVY 130
              .|::|.  .::::|     .|:|.    ||:.|..:  .:..||:..|......:  ::||.|
plant    66 --TEISSG--KLVIEV-----SYFGW----HIHSETHDLCDETSCPVAIGDFLVAHS--QVLPGY 115

  Fly   131 --PT 132
              ||
plant   116 TPPT 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 23/114 (20%)
AT3G11780NP_001189862.1 PG-PI_TP 27..160 CDD:238459 23/114 (20%)

Return to query results.
Submit another query.