DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and AT2G16005

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_565385.1 Gene:AT2G16005 AraportID:AT2G16005 Length:160 Species:Arabidopsis thaliana

Alignment Length:71 Identity:17/72 (24%)
Similarity:30/72 (42%) Gaps:23/72 (32%)


  Fly     1 MKLSLGLFVIFAALIGFTSSTDVSQCPKS--------------KSKALAAG---DVSISNCPKSK 48
            :||::|:|.:.....   |..|::.||.:              :.|..|.|   .:||::.|..:
plant    76 LKLAVGMFPVSTKSY---SLCDITACPVAPGPIVLTLPNIFTPREKRTAIGYTIIISITDKPLKE 137

  Fly    49 ---CIL 51
               |||
plant   138 SMMCIL 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 11/50 (22%)
AT2G16005NP_565385.1 PG-PI_TP 27..146 CDD:238459 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11306
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.