DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and Npc2

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_075898.1 Gene:Npc2 MGIID:1915213 Length:149 Species:Mus musculus

Alignment Length:155 Identity:40/156 (26%)
Similarity:69/156 (44%) Gaps:13/156 (8%)


  Fly     5 LGLFVIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPERDF 69
            |...::..||:. .|..:........||.....:|::|.||...|.|.:....|:.:........
Mouse     4 LAATILLLALVA-ASQAEPLHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQS 67

  Fly    70 QELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKK-VGCPLKAGQVYTYKNSFKILPVYPTV 133
            |..|:.:.||:..:.:|||          |.:..|.|. :.||::..:||:|.|...:...||::
Mouse    68 QNSTALVHGILEGIRVPFP----------IPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSI 122

  Fly   134 SLEIHWGL-GDKHGDAACFQIPAKI 157
            .|.:.|.| .||..:..|::||.:|
Mouse   123 KLVVEWKLEDDKKNNLFCWEIPVQI 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 35/134 (26%)
Npc2NP_075898.1 Npc2_like 24..145 CDD:238458 35/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4063
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6567
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11306
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.820

Return to query results.
Submit another query.