DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and zgc:193725

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001122191.1 Gene:zgc:193725 ZFINID:ZDB-GENE-080723-11 Length:149 Species:Danio rerio

Alignment Length:154 Identity:34/155 (22%)
Similarity:60/155 (39%) Gaps:15/155 (10%)


  Fly     7 LFVIFAALIGFTSSTDVS--QCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPERDF 69
            |.||..:.:.:|.:..|.  .|.....|.:   .|.|..|.:..|.|.:....::.:........
Zfish     6 LAVILLSFLAYTCADPVKFVDCGSVHGKVV---QVDIKPCSQQPCQLHKGQSYTVNVTFISSVAS 67

  Fly    70 QELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSFKILPVYPTVS 134
            |...:.:.|::..||:|||       .|  .|:..:..:.||:...:.|.|.....:...||.:.
Zfish    68 QTSKAVVHGVVECVPVPFP-------IP--IDDGCKSGIQCPIVPQKPYNYVTELPVKTEYPAIK 123

  Fly   135 LEIHWGL-GDKHGDAACFQIPAKI 157
            :.:.|.| .|...|..|.:.|.:|
Zfish   124 VVVEWELRDDSSKDLFCIKFPVQI 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 29/135 (21%)
zgc:193725NP_001122191.1 Npc2_like 24..145 CDD:238458 28/133 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4063
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1612792at2759
OrthoFinder 1 1.000 FOG0001503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11306
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.