DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and npc2.2

DIOPT Version :9

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001122191.1 Gene:npc2.2 / 565099 ZFINID:ZDB-GENE-080723-11 Length:149 Species:Danio rerio


Alignment Length:154 Identity:34/154 - (22%)
Similarity:60/154 - (38%) Gaps:15/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFVIFAALIGFTSSTDVS--QCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPERDF 69
            |.||..:.:.:|.:..|.  .|.....|.:   .|.|..|.:..|.|.:....::.:........
Zfish     6 LAVILLSFLAYTCADPVKFVDCGSVHGKVV---QVDIKPCSQQPCQLHKGQSYTVNVTFISSVAS 67

  Fly    70 QELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSFKILPVYPTVS 134
            |...:.:.|::..||:|||       .|  .|:..:..:.||:...:.|.|.....:...||.:.
Zfish    68 QTSKAVVHGVVECVPVPFP-------IP--IDDGCKSGIQCPIVPQKPYNYVTELPVKTEYPAIK 123

  Fly   135 LEIHWGL-GDKHGDAACFQIPAKI 157
            :.:.|.| .|...|..|.:.|.:|
Zfish   124 VVVEWELRDDSSKDLFCIKFPVQI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 28/134 (21%)
npc2.2NP_001122191.1 Npc2_like 24..145 CDD:238458 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49115
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.