DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and npc2

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_012823720.1 Gene:npc2 XenbaseID:XB-GENE-6258064 Length:156 Species:Xenopus tropicalis

Alignment Length:160 Identity:41/161 (25%)
Similarity:66/161 (41%) Gaps:19/161 (12%)


  Fly     6 GLFVIFAALIGFTSST----DVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPE 66
            ||..:...:....||.    ....|.....|.:.   :.:|.||:..|.|.|.:..::.......
 Frog     9 GLLTVLLTVFLLPSSVPEPLKYKDCGSQSGKLVT---LDVSPCPEEPCPLVRGSTYTVNATFVSN 70

  Fly    67 RDFQELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKK-VGCPLKAGQVYTYKNSFKILPVY 130
            .:.:..::.:.|||..:.:|||          |.:..|.|. :.||:.:||.|||.....|...|
 Frog    71 VNSKSASAVVHGIIAGIAVPFP----------ISEPDGCKSGISCPINSGQTYTYVTKLPIKSEY 125

  Fly   131 PTVSLEIHWGLGDKHG-DAACFQIPAKIKA 159
            |.:.|.:.|.|.|::. |..|:.||..|.|
 Frog   126 PCIKLVVKWQLQDENNKDLFCWLIPVHIAA 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 35/134 (26%)
npc2XP_012823720.1 Npc2_like 30..151 CDD:238458 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4063
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1612792at2759
OrthoFinder 1 1.000 FOG0001503
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.780

Return to query results.
Submit another query.