DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and Npc2g

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001247375.1 Gene:Npc2g FlyBaseID:FBgn0039800 Length:159 Species:Drosophila melanogaster

Alignment Length:165 Identity:39/166 (23%)
Similarity:60/166 (36%) Gaps:24/166 (14%)


  Fly     4 SLGLFVIFAALIGFTSSTDV---SQCPKSKSKALAAGDVSISNCPK----SKCILKRNTEASIQM 61
            ||....|...||..::|.:|   ..||.|.. ......|.:|.||:    :.|.::|...:.:..
  Fly     6 SLQAVAIAIVLISSSASAEVVNFEPCPDSVD-TCTIQQVRVSPCPEALNNAACNIRRKHNSEMSF 69

  Fly    62 KIRPERDFQELTSDI---QGIILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNS 123
            ...|..|...|.:.:   :...:::||            ...|.|..|...||:::|...||...
  Fly    70 DFTPNFDADTLVASLGWAKSENVELPL------------LTLDSAACKYTPCPVRSGVKQTYTTL 122

  Fly   124 FKILPVYPTVSLEIHWGLGDKHGD-AACFQIPAKI 157
            ..|...:|.....|.|.|.|.... ..||.|..|:
  Fly   123 VPIEAKFPLSPYTIRWALKDPVSQKRCCFTIDIKV 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 32/143 (22%)
Npc2gNP_001247375.1 Npc2_like 28..155 CDD:238458 31/140 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6567
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001503
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11306
RoundUp 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.