DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and Npc2c

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_649976.1 Gene:Npc2c FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster

Alignment Length:170 Identity:46/171 (27%)
Similarity:74/171 (43%) Gaps:29/171 (17%)


  Fly     2 KLSLGLFVIFAALIGFTSSTDVSQCPKSK-SKALAAGDVSISNCPKSKCILKRNTEASIQMKIRP 65
            ||||.| |:.........||.:.||..|. .:.|.   |.|.:|....|.|.:.|||.|.::...
  Fly     6 KLSLCL-VLSIMWTSVADSTPIRQCADSNYPQPLM---VQIDDCDALPCDLWKGTEAKIDIQFVA 66

  Fly    66 ERD-FQELTSDIQGIILDVPLPFP-----GYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSF 124
            .|: .::|::::....|.|.:|:.     |    :.|.::...|     .|||.||:..||:   
  Fly    67 TRNTMKKLSAEVHLTSLGVTIPYDLEASRG----NVCSNLLHGA-----YCPLDAGEDVTYQ--- 119

  Fly   125 KILPV---YPTVSLEIHWGL---GDKHGDAACFQIPAKIK 158
            .:|||   .|.|...:...|   .|::...:||....::|
  Fly   120 LLLPVTTNQPEVPTRLEVRLLDSDDENRVVSCFLADTRVK 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 37/145 (26%)
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 37/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4063
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1612792at2759
OrthoFinder 1 1.000 FOG0001503
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11306
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.