DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and Npc2d

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_649975.1 Gene:Npc2d FlyBaseID:FBgn0037782 Length:173 Species:Drosophila melanogaster

Alignment Length:159 Identity:39/160 (24%)
Similarity:69/160 (43%) Gaps:14/160 (9%)


  Fly     3 LSLGLFVIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPER 67
            :||||.:..|.......:|.|.:|..||...|   :|.:.||....|.:.:.|....::....::
  Fly     9 ISLGLLLSLAEAQQEHPATSVKKCSGSKPFPL---EVRVHNCVTPPCQIVKGTTQKFEIDFAVDK 70

  Fly    68 DFQELTSDIQGI---ILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSFKILPV 129
            ...:||:.::..   |:.||...|... .:.||::     :....|||...:..:|..:|.| ..
  Fly    71 YITQLTTLVKATTLGIITVPYELPADV-AAVCPNL-----QYGAYCPLYPTEDVSYLFTFPI-GE 128

  Fly   130 YPTVSLEIHWGLGDKHGD-AACFQIPAKI 157
            ||.:.::|...|.|:..: |.||....|:
  Fly   129 YPEIGVKIEIYLVDQDNEIATCFVCDIKV 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 32/136 (24%)
Npc2dNP_649975.1 Npc2_like 29..155 CDD:238458 32/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4063
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6567
OrthoDB 1 1.010 D1612792at2759
OrthoFinder 1 1.000 FOG0001503
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11306
RoundUp 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.