DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and Npc2a

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_608637.1 Gene:Npc2a FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster

Alignment Length:150 Identity:49/150 (33%)
Similarity:74/150 (49%) Gaps:14/150 (9%)


  Fly    12 AALIGFTSSTDVSQCPKSKSKALAAGDVSISNC--PKSKCILKRNTEASIQMKIRPERDFQELTS 74
            |||:.|..:.:.|.|.....|...   |:|..|  .|::|||||||..|..:......:...:.:
  Fly    10 AALVVFAGALEFSDCGSKTGKFTR---VAIEGCDTTKAECILKRNTTVSFSIDFALAEEATAVKT 71

  Fly    75 DIQGIILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSFKILPVYPTVSLEIHW 139
            .:.|.:|.:.:|||     .|.|....::|.|   |||:..:.|.|..:..:|..||.||:.:.|
  Fly    72 VVHGKVLGIEMPFP-----LANPDACVDSGLK---CPLEKDESYRYTATLPVLRSYPKVSVLVKW 128

  Fly   140 GLGDKHG-DAACFQIPAKIK 158
            .|.|:.| |..|.:|||||:
  Fly   129 ELQDQDGADIICVEIPAKIQ 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 42/135 (31%)
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458 42/135 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4063
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1612792at2759
OrthoFinder 1 1.000 FOG0001503
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11306
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.