DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and npc2

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_775331.1 Gene:npc2 ZFINID:ZDB-GENE-021206-13 Length:149 Species:Danio rerio

Alignment Length:154 Identity:33/155 (21%)
Similarity:61/155 (39%) Gaps:15/155 (10%)


  Fly     7 LFVIFAALIGFTSSTDVS--QCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPERDF 69
            |.|:..:.:.:|.:..|.  .|.....|.:   .|.|..|.:..|.|.:....::.:......:.
Zfish     6 LGVVLLSFLAYTCADPVKFVDCGSVDGKVV---QVDIKPCSQQPCKLHKGQSYTVNVTFSSGVES 67

  Fly    70 QELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSFKILPVYPTVS 134
            |...:.:.|::..||:|||       .|  .|:..:..:.||:...:.|.|.....:...||.:.
Zfish    68 QTSKAVVHGVLAGVPVPFP-------IP--IDDGCKSGIQCPIVPQKPYNYVTELPVKTEYPAIK 123

  Fly   135 LEIHWGL-GDKHGDAACFQIPAKI 157
            :.:.|.| .|...|..|.:.|.:|
Zfish   124 VVVEWELRDDSSKDLFCIKFPVQI 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 29/135 (21%)
npc2NP_775331.1 Npc2_like 24..145 CDD:238458 28/133 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4063
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1612792at2759
OrthoFinder 1 1.000 FOG0001503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11306
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.