DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and heh-1

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_497671.2 Gene:heh-1 WormBaseID:WBGene00006452 Length:154 Species:Caenorhabditis elegans

Alignment Length:161 Identity:37/162 (23%)
Similarity:63/162 (39%) Gaps:22/162 (14%)


  Fly     9 VIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCP------KSKCILKRNTEASIQMKIRPER 67
            |||.||:|..::..:....|..........|....|.      |..|:.|:.:...||:..:|.:
 Worm     4 VIFLALLGLAAAEFIEIGYKVCKSDGTVSQVKADGCELTVKDGKKVCLFKKGSRPIIQIAFKPSK 68

  Fly    68 DFQELTSDIQGIILDVPLPFPGYYGTSAC---PHIYDEAGEKKVGCPLKAGQVYTYKNSFKILPV 129
            |..:|.:.::..:           |.||.   |....:|....|.||:.||:...::.|..|...
 Worm    69 DTDKLKTSVRAKV-----------GGSAMVDFPQTNSDACTYGVKCPVSAGENQIFEQSISITEN 122

  Fly   130 YPTVS-LEIHWGL-GDKHGDAACFQIPAKIK 158
            :|... ::::|.| ....|...|....|:||
 Worm   123 HPAGEVIQVNWQLTRPDSGKEVCIIFLAEIK 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 28/143 (20%)
heh-1NP_497671.2 Npc2_like 22..150 CDD:238458 28/139 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4063
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1612792at2759
OrthoFinder 1 1.000 FOG0001503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11306
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.