DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Npc2b and NPC2

Sequence 1:NP_650331.1 Gene:Npc2b FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001350617.1 Gene:NPC2 HGNCID:14537 Length:174 Species:Homo sapiens

Alignment Length:122 Identity:33/123 (27%)
Similarity:59/123 (48%) Gaps:12/123 (10%)


  Fly    38 DVSISNCPKSKCILKRNTEASIQMKIRPERDFQELTSDIQGIILDVPLPFPGYYGTSACPHIYDE 102
            :|::|.||...|.|.:....|:.:........:...:.:.||::.||:|||          |.:.
Human    36 EVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFP----------IPEP 90

  Fly   103 AGEKK-VGCPLKAGQVYTYKNSFKILPVYPTVSLEIHWGL-GDKHGDAACFQIPAKI 157
            .|.|. :.||::..:.|:|.|...:...||::.|.:.|.| .||:....|::||.:|
Human    91 DGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 32/119 (27%)
NPC2NP_001350617.1 Npc2_like 24..145 CDD:238458 32/119 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4063
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1612792at2759
OrthoFinder 1 1.000 FOG0001503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11306
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.