DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3061 and CG5001

Sequence 1:NP_650328.1 Gene:CG3061 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster

Alignment Length:170 Identity:61/171 (36%)
Similarity:84/171 (49%) Gaps:39/171 (23%)


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169
            ||||::||:.|||||.||||||:||||:.|||||||..|.:.||.:..|..||:|..||:.||.|
  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67

  Fly   170 GINESHNGHGNNGG------GHHGHG-------QYYNNEYGYSRGFQA----------DISAE-E 210
            |.:...:|...|||      .:..||       |::.|...::..|..          |:..| :
  Fly    68 GEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPD 132

  Fly   211 LFNMFFNG---------GFPQQ------NVHMRQQRRRQQ 235
            .|:..|.|         ||...      |||...::.::|
  Fly   133 FFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQ 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 57/158 (36%)
DnaJ 106..167 CDD:278647 37/61 (61%)
DUF1977 269..366 CDD:286411
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 61/171 (36%)
DnaJ 4..65 CDD:278647 37/61 (61%)
DnaJ_C 174..338 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116669886
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.