DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9925 and Tdrd6

DIOPT Version :8

Sequence 1:NP_650324.1 Gene:CG9925 / 41702 FlyBaseID:FBgn0038191 Length:892 Species:Drosophila melanogaster
Sequence 2:NP_001178512.1 Gene:Tdrd6 / 316254 RGDID:1305956 Length:2136 Species:Rattus norvegicus

Alignment Length:896 Identity:170/897 (19%)
Similarity:301/897 (34%) Gaps:306/897 (34%)


  Fly    73 AKTRTKSPIPCVEPTVAVPNKPDLSENWRKHLLPSGMEFFKCRVTFMENDGPIWVVHVANVEAIE 137
            |..:::||...:|..|::|:...:.....        .|:..:|.|:::....|:....:.....
  Rat   464 AAFQSQSPAEEMEEEVSLPSLRSIRLKMN--------TFYDAQVEFVKSPSEFWIRLRKHKNTFS 520

  Fly   138 RMTVNMQRCMQNKKMIRMEGV----REDTLVAISVGDKVHRGHVLTVCQKKQEANVRMIDHGQIV 198
            ::|..|  |.......:::||    ..|.|..:...:..:...::|....| ..:|.::|.|...
  Rat   521 KLTKRM--CSFYSSASKLDGVILKPEPDDLCCVKWKENGYYRAMVTRLDSK-SVDVFLVDRGNSE 582

  Fly   199 ATPFRDIYTIVPKMAESKAFAFRVQLPTNTGVQDIKNLTLRMLGTKTSDGAYHVHLKPKMIIPLS 263
            ...:.|:..::|:        || |||.                                   |:
  Rat   583 NVDWCDVRMLLPQ--------FR-QLPI-----------------------------------LA 603

  Fly   264 LPLEMLQLNP-----EVKVIRVFKANPKHNEPQLALLQINVMGHVNADLNNRIAEKPRQPFTLPF 323
            |...:..:.|     ..:.|..||....|.|     |.::::            :|..:.:.:..
  Rat   604 LKCTLADIWPLGKTWSQEAISFFKKTVLHKE-----LVVHIL------------DKQDRQYVIEI 651

  Fly   324 PEQKSIFFAATRTKNGYRRAFLLDHIMK--PRPTYLVYEMDEGRVSIATDLSRIPSELLGLPSRV 386
            .::       :||..        ::|.|  .:..|..::..|.:.:|     |:.:...|..|..
  Rat   652 LDE-------SRTGE--------ENISKVIAQAGYAKFQEFETKENI-----RLSAHSPGHVSGH 696

  Fly   387 FAAQLEDSVPEELETQGAELTVKFKLDNKPPKEKLRAANAALNSKGEQICMARLITFLGQISYLG 451
            |.|: ...:|...:.:|.:   |.|.|||...:....|..:|::           ...||.:   
  Rat   697 FIAE-SSKIPSVKKVEGDQ---KAKNDNKTLSDPEALATVSLSN-----------ISTGQTA--- 743

  Fly   452 HKYWREPIVHDSIVFISHLVSFKEVYISTPDAKQYAEIFKRLEYKCATITKSSDVSVGSIVLV-V 515
              ..:|.:..|..:.:.:|:..|      ||.             |.    ..::.|||.|.| |
  Rat   744 --QDKEKVTSDPTLLMLNLLKTK------PDC-------------CG----KGELEVGSTVEVKV 783

  Fly   516 S--KQMGHFRGEILSKDSGLFEVM--------------NVDTGATQKVELAEIR------SSCRF 558
            |  :..|.|..:::....|...:|              ..||.|......|..|      |..:.
  Rat   784 SHIENPGSFWCQLMRNAQGFRTLMCDIEDYCKSEPSPYEGDTRACLAKRTANGRWSRALISGAQS 848

  Fly   559 LENLPVCLMR------VQLQNVCNIPDAAVPVNNAAIQMLHKLCAQKELLK----------LNMV 607
            ||::.|..:.      |.::::.::.|....|...|.:     |:...|::          ...:
  Rat   849 LEHVRVVFVDYGDKDVVSMKDILSVSDVFFKVRAQAFR-----CSLYNLIQPTGENPFVWDERAI 908

  Fly   608 DATTSTVDLLFSSGDSRSLTTQMLPL-----------IFTPVQEKAEVAPPKAASTPSQLPVVTH 661
            .|.|..:|..:.:......|...|..           :.||.|........|..:.|.:|     
  Rat   909 QAFTGFIDNAWQNNLELKCTIFALASRHEEECFNVVDLLTPFQSACHFLVEKRLARPVKL----- 968

  Fly   662 KQQKVSPQSLLLLDLPPLPPSPPESPFPADVTSTKSASHVLPIKRFLFDALPKNLAPLGDKVNLI 726
              ||            ||.||       ..:.|...::|.|.|               |.:..:.
  Rat   969 --QK------------PLEPS-------VQLHSYYYSTHDLKI---------------GSEELVY 997

  Fly   727 LMNADGLPQTGYITAAYFKDEKAAKEF--------EKILSLTSSQGACDHNVVPGYVPNVGELCL 783
            :.:||. |.|.|...|  ::....::.        :.:|:|.:|      .:||      |.|||
  Rat   998 ITHADD-PWTFYCQLA--RNTNILEQLSYHIMQLSKVLLNLRTS------TLVP------GTLCL 1047

  Fly   784 AIYSEDKNWYRGVCQEVKDNMVKILFCDFGNTEYVAVRHVKPISQD----LLIAVNVTKCYING- 843
            |.|: |.|||||:..|.:.:  |:.|.||||| |||..|:.||.:|    ||:.:...||.::. 
  Rat  1048 AKYT-DGNWYRGIIIEKEPS--KVFFVDFGNT-YVASDHLLPIPRDAYDVLLLPMQAVKCSLSDI 1108

  Fly   844 ----------------FDKSKNFAALEQFLVRKIRFLCGVKKGPEPDTRLI 878
                            .|||     |:..:|.|           :||.|||
  Rat  1109 PHHIPEEVTAWFQETVLDKS-----LKALVVAK-----------DPDGRLI 1143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9925NP_650324.1 zf-MYND 9..44 CDD:280009
TUDOR 109..225 CDD:278965 22/120 (18%)
TUDOR 457..573 CDD:278965 28/145 (19%)
TUDOR 718..843 CDD:278965 43/137 (31%)
TUDOR 779..825 CDD:119391 24/46 (52%)
Tdrd6NP_001178512.1 TUDOR 10..133 CDD:278965
TUDOR 245..379 CDD:278965
TUDOR 313..359 CDD:119391
TUDOR 489..610 CDD:278965 25/176 (14%)
TUDOR 547..591 CDD:119391 7/45 (16%)
TUDOR 775..891 CDD:278965 25/121 (21%)
TUDOR 827..870 CDD:119391 8/43 (19%)
TUDOR 988..1107 CDD:278965 45/153 (29%)
TUDOR 1043..1085 CDD:119391 24/46 (52%)
TUDOR 1310..1429 CDD:278965
TUDOR 1363..1407 CDD:119391
TUDOR 1523..1645 CDD:278965
TUDOR 1578..>1616 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001664
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22948
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.