DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9925 and TDRD6

DIOPT Version :8

Sequence 1:NP_650324.1 Gene:CG9925 / 41702 FlyBaseID:FBgn0038191 Length:892 Species:Drosophila melanogaster
Sequence 2:NP_001010870.1 Gene:TDRD6 / 221400 HGNCID:21339 Length:2096 Species:Homo sapiens

Alignment Length:933 Identity:174/934 (19%)
Similarity:326/934 (35%) Gaps:307/934 (33%)


  Fly     1 MEKSEEKTCVVCGTPTRLMCQRCGEPYCNEKCQKLDWQRHRQVCIIMPPLVECRPLQPALNPIQS 65
            :.|:...|.||....|.|:.|                ::.::..:..|.:..|..::|..:....
Human   719 VSKALSDTTVVTNGSTELVVQ----------------EKVKRASVYFPLMQNCLEIKPGSSSKGE 767

  Fly    66 VENQVALAKTRTKSPIPCVEPTVAVPNKPDLSENWRKHLLPSGMEFFKCRVTFMENDGPIWVVHV 130
            :|                |..||.|                        ||:::||.|..|....
Human   768 LE----------------VGSTVEV------------------------RVSYVENPGYFWCQLT 792

  Fly   131 ANVEAIERMTVNMQRCMQNKKMIRMEGVREDTLVAI---SVGDKVHRGHVLTVCQKKQEANVRMI 192
            .|::.::.:..::|...:|.....    :.:||..:   :|..:..|. :::..|..:..||..:
Human   793 RNIQGLKTLMSDIQYYCKNTAAPH----QRNTLACLAKRTVNRQWSRA-LISGIQSVEHVNVTFV 852

  Fly   193 DHGQIVATPFRDIYTIVPKMAESKAFAFRVQL-----PT--NTGVQDI---------------KN 235
            |:|.......::||:|..:..:.||.|||..|     |.  |..|.|:               ||
Human   853 DYGDREMVSVKNIYSISEEFLKVKAQAFRCSLYNLIQPVGQNPFVWDVKAIQAFNEFIDNAWQKN 917

  Fly   236 LTLR----MLGTKTSD------------GAYHVHLKPKMIIPLSL--PLE-MLQLNPEVKVIRVF 281
            |.|:    .|.:...:            .|.|..::.::..|:.|  ||| .:||:.........
Human   918 LELKCTIFALASINEELFNIVDLLTPFQSACHFLVEKRLARPVKLQKPLESSVQLHSYFYSTHDM 982

  Fly   282 KANPKH-------NEPQLALLQI----NVMGHVNADLNN------RIAEKPRQPFTLPFPEQKSI 329
            |...:.       ::|.....|:    |::..::..:..      .:...|..|.||        
Human   983 KIGSEELVYITHIDDPWTFYCQLARNANILEQLSCSITQLSKVLLNLKTSPLNPGTL-------- 1039

  Fly   330 FFAATRTKNGYRRAFLLDHIMKPRPTYLVYEMDEGRVSIAT--DLSRIPS---ELLGLPS---RV 386
             ..|..|...:.|..:::  .:|:..:.|   |.|.:.:.|  ||..|||   ::|.||.   |.
Human  1040 -CLAKYTDGNWYRGIVIE--KEPKKVFFV---DFGNIYVVTSDDLLPIPSDAYDVLLLPMQAVRC 1098

  Fly   387 FAAQLEDSVPEELETQGAELTVKFKLDNKPPKEKLRAANAALNSKGEQICMARLITFLGQISYLG 451
            ..:.:.|.:|||:..                                                  
Human  1099 SLSDIPDHIPEEVVV-------------------------------------------------- 1113

  Fly   452 HKYWREPIVHDSIVFISHLVSFKEVYISTPDAKQYAEIFKRLEYKCATITKSSDVSVGSIVLVVS 516
              :::|.|:..|   :..||..|:     ||.....|::            ..::.:.:   .::
Human  1114 --WFQETILDKS---LKALVVAKD-----PDGTLIIELY------------GDNIQISA---SIN 1153

  Fly   517 KQMG--HFRGEILSKDSGLFEVMNVDTGATQKVELAEIRSSC-RFLENLPVCLMRVQLQNVCNIP 578
            |::|  .::..|..|:|   ||: ..|..|.:.:...::..| .:|..    .:..:|.|...:.
Human  1154 KKLGLLSYKDRIRKKES---EVL-CSTTETLEEKNENMKLPCTEYLSK----SVGYKLPNKEILE 1210

  Fly   579 DAAVPVNNAAIQMLHKLCAQKELLKLNMVDATTSTVDLLFSSGDSRSLTTQMLPLIFTPVQEKAE 643
            ::..|..|::.:.|..|   :.|.|.|:|.....:|      |:..|   |:.||          
Human  1211 ESYKPQINSSYKELKLL---QSLTKTNLVTQYQDSV------GNKNS---QVFPL---------- 1253

  Fly   644 VAPPKAASTPSQLPVVTHKQQKVSPQSLLLLDLPPLPPSPPESPFPADVTSTK---SASHVLPIK 705
                           .|.|::::|.::       ||..:..|    |.::..|   |....||:|
Human  1254 ---------------TTEKKEEISAET-------PLKTARVE----ATLSERKIGDSCDKDLPLK 1292

  Fly   706 RFLFDALPKNLAPLGDKVNLILMNADGLPQTGYITAAYFKDEKAAKEFEKILSLTSSQGACDHNV 770
               |...|:.....|.|..:.:.:.:.|... |:  ...:||.......:.|:...::       
Human  1293 ---FCEFPQKTIMPGFKTTVYVSHINDLSDF-YV--QLIEDEAEISHLSERLNSVKTR------- 1344

  Fly   771 VPGYV--PNV--GELCLAIYSEDKNWYRGVCQEVKDN-MVKILFCDFGNTEYVAVRHVKPISQ-D 829
             |.|.  |.:  |::..|::.||..|||.|.:|.:.| ::.:.|.|:||   |:|.|...|.: |
Human  1345 -PEYYVGPPLQRGDMICAVFPEDNLWYRAVIKEQQPNDLLSVQFIDYGN---VSVVHTNKIGRLD 1405

  Fly   830 LLIAV---NVTKCYINGFDKSKN 849
            |:.|:   ....|.:.||:...|
Human  1406 LVNAILPGLCIHCSLQGFEVPDN 1428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9925NP_650324.1 zf-MYND 9..44 CDD:280009 5/35 (14%)
TUDOR 109..225 CDD:278965 27/124 (22%)
TUDOR 457..573 CDD:278965 21/119 (18%)
TUDOR 718..843 CDD:278965 32/134 (24%)
TUDOR 779..825 CDD:119391 17/47 (36%)
TDRD6NP_001010870.1 TUDOR <69..133 CDD:278965
TUDOR 246..380 CDD:278965
TUDOR 314..360 CDD:119391
TUDOR 483..604 CDD:278965
TUDOR 541..585 CDD:119391
TUDOR 770..886 CDD:278965 31/145 (21%)
TUDOR 821..866 CDD:119391 9/46 (20%)
TUDOR 982..1102 CDD:278965 25/134 (19%)
TUDOR 1037..1080 CDD:119391 12/57 (21%)
TUDOR 1301..1422 CDD:278965 32/135 (24%)
TUDOR 1356..1401 CDD:119391 17/48 (35%)
TUDOR 1516..1638 CDD:278965
TUDOR 1571..>1609 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001664
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.