DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9925 and TDRD10

DIOPT Version :8

Sequence 1:NP_650324.1 Gene:CG9925 / 41702 FlyBaseID:FBgn0038191 Length:892 Species:Drosophila melanogaster
Sequence 2:XP_011507454.1 Gene:TDRD10 / 126668 HGNCID:25316 Length:398 Species:Homo sapiens

Alignment Length:273 Identity:50/274 (18%)
Similarity:94/274 (34%) Gaps:60/274 (22%)


  Fly   646 PPKAASTPSQLPVVTHKQQKVSPQ----SLLLLDLPPLPPSPPESPFPADVTST---KSASHVLP 703
            |||......|.|......:|.|.:    :..::.|.|        ..|.|:..|   ::|...:|
Human   140 PPKRTPDMIQQPRAPLVLEKASGEGFGKTAAIIQLAP--------KAPVDLCETEKLRAAFFAVP 196

  Fly   704 IK---RFLFDALPKNLAPLG---------DKVNLILMNADGLPQTGYITAAYFKDEKAAKEFEKI 756
            ::   .||...|.:....|.         .:..|::.:.  :|:|.:..|.:..:  |..:..:.
Human   197 LEMRGSFLVLLLRECFRDLSWLALIHSVRGEAGLLVTSI--VPKTPFFWAMHVTE--ALHQNMQA 257

  Fly   757 LSLTSSQGACDHNVVPGYVPNVGELCLAIY---SEDKNWYRGVCQEVKDNMVKILFCDFGNTEYV 818
            |..|.:|.......:.|.....|..|||.|   .....|.|....:..|....::|.|||....:
Human   258 LFSTLAQAEEQQPYLEGSTVMRGTRCLAEYHLGDYGHAWNRCWVLDRVDTWAVVMFIDFGQLATI 322

  Fly   819 AVRHVK-----------PISQDLLIAVNVTKCY--INGFDKSKNFAALEQFLVRKIRFLCGVKKG 870
            .|:.::           |::|..::..::...|  ::...|.|...||...:.            
Human   323 PVQSLRSLDSDDFWTIPPLTQPFMLEKDILSSYEVVHRILKGKITGALNSAVT------------ 375

  Fly   871 PEPDTRLITIPDM 883
             .|.:.|..:|.:
Human   376 -APASNLAVVPPL 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9925NP_650324.1 zf-MYND 9..44 CDD:280009
TUDOR 109..225 CDD:278965
TUDOR 457..573 CDD:278965
TUDOR 718..843 CDD:278965 26/150 (17%)
TUDOR 779..825 CDD:119391 13/60 (22%)
TDRD10XP_011507454.1 RRM <7..>135 CDD:223796
RRM_SF 77..134 CDD:302621
TUDOR <251..347 CDD:278965 19/96 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.