DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9925 and LOC110438056

DIOPT Version :8

Sequence 1:NP_650324.1 Gene:CG9925 / 41702 FlyBaseID:FBgn0038191 Length:892 Species:Drosophila melanogaster
Sequence 2:XP_021323213.1 Gene:LOC110438056 / 110438056 -ID:- Length:1673 Species:Danio rerio

Alignment Length:1010 Identity:192/1011 (19%)
Similarity:334/1011 (33%) Gaps:285/1011 (28%)


  Fly    23 CGEPYC--------------NEKCQKLDWQRHRQVCIIMPPLVECRPLQPALNPIQSVENQVALA 73
            ||:|..              |:..|.|. ..|         |.||......:|.:...:.:..|.
Zfish   429 CGDPTLDTLNKVTYGNMHGRNDSLQSLH-SAH---------LTECSSSVEDVNVVGPSKAEGNLQ 483

  Fly    74 KTR--------TKSPIPCVEPTVAVPNKPDLSENWRKHLLPSGMEFFKCRVTFMENDGPIWVVHV 130
            .|:        |.||:. .:..|.||.|..:....:.|            :|.:::....:....
Zfish   484 STKGGYTLNAATTSPLQ-TDAYVDVPPKIKVGAKMKLH------------ITCVQSVNQFYGHFA 535

  Fly   131 ANVEAIERMTVNMQRCMQNKKMIRMEGVREDTLVAISVGDKVHRGHVLTVCQKKQEANVRMIDHG 195
            .|.:|:.:||.::|:..:.:...:.....:...:|.....:.|||.:.:|..|   ..|:.:|:|
Zfish   536 QNTDAVTKMTKDIQQLCRKRPQAKFSISPKMMCLAKFSDGQWHRGQIESVHPK---ILVQFVDYG 597

  Fly   196 QIVATPFRDIYTIVPKMAESKAFA-----------FRVQLP---------TNTGVQDIKNLTLRM 240
            .:|.....||....|   .:.|.|           |.|.||         .|.....:.|:.:::
Zfish   598 DLVVVDKSDILPFPP---NANAIASLPIQAVQFELFNVALPEPCELNEWFKNYATDCMFNVVVKL 659

  Fly   241 -----LGTKTSDGAYHVHLKPKMIIPLSLPLEMLQLNPEVK---------------VIRVFKANP 285
                 |..:..|...:::||.|.:...:...|.:.....||               |...|....
Zfish   660 NSSGKLSVEMYDDKTNLNLKIKDLWSKTKRNESINTKGIVKTRGFKETSEGMEFREVRNSFSTTS 724

  Fly   286 KHNEPQL-----ALLQIN---VMGHVNADLNNRIAEKPRQPFTLPFPEQKSIFFAATRTKN-GYR 341
            :.:|..|     |..:.|   ..|:.||..|||......|...:.:|:...:   ..||.: ||.
Zfish   725 QAHERTLKPVGQARTEQNFQSATGYSNATGNNRAWPNVLQQQVMAYPKLTEL---PLRTIDVGYV 786

  Fly   342 RAFLLDHIMKPRPTYLVYEMDEGRV---------SIATDLSRIPSELLGLPSRVFAAQLEDSVPE 397
            ....:.|...|...::....||..:         ::.:|| ::...||         |.:|.|..
Zfish   787 SDVYVSHCNSPSNFFVQLTTDEDEIFSLIEKLNCTLISDL-QVELNLL---------QSDDLVKA 841

  Fly   398 ELETQGA--ELTVKFKLDNKPPKEKLRAAN--AALNSKGEQI-------------CM-------- 437
            |....||  ...||.|.:.....:.:...|  ..|.:|.:|:             ||        
Zfish   842 EYPADGAYYRAVVKSKKNGMVQVQFIDFGNEVTLLPTKIKQLDKQFLSTPRLSIQCMLEDGKRRG 906

  Fly   438 ------ARLITFLGQISYLGHK------------YWREPIVHDSIVFI----------------S 468
                  ..::||.......|.|            .|...:.|....|.                :
Zfish   907 KRDWTQEEIMTFKEAAGENGEKKIQCKFIQEDANCWLVSLEHQEGWFTVKSDAQSESQVHCIKNT 971

  Fly   469 HLVSFK----------EVYISTPDAKQY-------AEIFKRLEYKCATITKSSDVSV-------- 508
            ..::||          |.|.|:.....|       :||..::......|..||....        
Zfish   972 QPLTFKKPAVTPGQTVEAYASSIVGPNYFWCQFKNSEILDKISLLAQEIGNSSHTKAIQPDQLRQ 1036

  Fly   509 GSIVLVVSKQMGHFRGEILS---KDSGLFEVMNVDTGATQKVELAEIRS-SCRFLENLPVCLMRV 569
            |.|.|........:|.::::   |.|.||    :|.|...:::...|:: ..:.||:.|...: .
Zfish  1037 GGICLARFSDQLWYRAQVINTHEKVSVLF----IDYGNESEIDFNSIKALPTKLLESPPQAFL-C 1096

  Fly   570 QLQNVCNI----PDAA--------------VPVNNAAIQMLHKLCAQ-------KELLKLNMVDA 609
            |||.:.::    .|:|              |.|.|..:.....:|.|       |||:..:::..
Zfish  1097 QLQVLGSVEGTWSDSAADKFFEILVDEPLKVTVQNMVVTPNPTMCPQFSVLVECKELIVNDLMKD 1161

  Fly   610 TTSTVDLLFSSGDSRSLTT---QMLPLIFTPVQEKAEVAPPKAASTPSQLPVVTHKQQKVSPQSL 671
            ..|......||..|.:.|.   ....:..:...:|.:.....:::|||        ...|:..:.
Zfish  1162 FLSDPKPQVSSKGSMAKTNAGKDDFGVTNSEAVQKNKTPNLNSSTTPS--------IDDVNNSAA 1218

  Fly   672 LLLDLPPLPPSPPESPFPADVTSTKSASHVLPIKRFLFDALPKNLAPLGDKVNLILMNADGLPQT 736
            |...:..:.|...:| ||..|.                  ||:.:...|....:.:.:.:.| ::
Zfish  1219 LTTGVNMMDPESMQS-FPRSVD------------------LPQRVIQPGTMSEVYISHINNL-RS 1263

  Fly   737 GYITAAYFKDEKAAKEFEKIL-SLTSSQGA---CDHNVVPGYVPNVGELCLAIYSEDKNWYRGVC 797
            .|:         ..||.|..| |||.|..:   .:.:.:.|.....|.|..|::.||.:|||.|.
Zfish  1264 FYV---------QLKEDENTLFSLTESLNSHQPSEKDEMHGLSVQQGSLVKAMFPEDDSWYRAVV 1319

  Fly   798 QEVKDN-MVKILFCDFGNTEYVAVRHVKPISQDLL 831
            :...:| ||.:.|.||||...|:...:..:.:.||
Zfish  1320 KCAPENDMVFVEFIDFGNEAMVSSLKICRLDEHLL 1354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9925NP_650324.1 zf-MYND 9..44 CDD:280009 7/35 (20%)
TUDOR 109..225 CDD:278965 24/127 (19%)
TUDOR 457..573 CDD:278965 30/161 (19%)
TUDOR 718..843 CDD:278965 32/120 (27%)
TUDOR 779..825 CDD:119391 18/47 (38%)
LOC110438056XP_021323213.1 TUDOR <65..128 CDD:306940
TUDOR 247..360 CDD:306940
TUDOR 511..631 CDD:306940 23/138 (17%)
TUDOR 787..899 CDD:306940 23/122 (19%)
TUDOR 983..1099 CDD:306940 25/121 (21%)
TUDOR 1245..1364 CDD:306940 32/121 (26%)
TUDOR 1453..1572 CDD:306940
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001664
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.