DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and lbx2

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:137 Identity:40/137 - (29%)
Similarity:58/137 - (42%) Gaps:44/137 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKR----- 445
            :|.::.||||:..|:.:||..|...:|:..|:|..:||.|.|:..||..||||||.|.||     
Zfish   124 KKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEM 188

  Fly   446 --------------MQQ-------EDEKGGEG---------------GSQRNMHNGSGDEDDDEL 474
                          :|:       ||..||.|               .|.|........|:|:|:
Zfish   189 KADVESLKKIPPQALQKLVSMEDMEDAHGGSGPISPSLSPRAFPQSPSSSRGQTTDEFSEEDEEI 253

  Fly   475 IDMEMDE 481
               |:|:
Zfish   254 ---EVDD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 24/55 (44%)
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Homeodomain 127..183 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.