DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and crx

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001016021.1 Gene:crx / 548775 XenbaseID:XB-GENE-478452 Length:290 Species:Xenopus tropicalis


Alignment Length:64 Identity:27/64 - (42%)
Similarity:41/64 - (64%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQE 449
            ||.:|.||.|:.:||..||..|...:|.....|:.:|..:||.|::|:|||:|||.|.::.||:
 Frog    36 RKQRRERTTFTRAQLDILEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQ 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 23/55 (42%)
crxNP_001016021.1 Homeodomain 39..94 CDD:459649 23/54 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..144 2/7 (29%)
TF_Otx 152..236 CDD:427350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.