DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and gsb-n

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:92 Identity:34/92 - (36%)
Similarity:48/92 - (52%) Gaps:8/92 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 PGSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRT 441
            ||   :|..||.:|.||.|:..||..||.||...||.....|:.|||...|:|.:::|||.|||.
  Fly   174 PG---IPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRA 235

  Fly   442 KHKRMQQEDEKGGEGGSQRNMHNGSGD 468
            :.::     ..||.......|::||.:
  Fly   236 RLRK-----HSGGSNSGLSPMNSGSSN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 24/55 (44%)
gsb-nNP_523862.1 HTH_CRP 20..141 CDD:481199
Homeodomain 183..239 CDD:459649 24/55 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.