DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and hoxa3

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001120901.1 Gene:hoxa3 / 100151729 XenbaseID:XB-GENE-482267 Length:406 Species:Xenopus tropicalis


Alignment Length:31 Identity:11/31 - (35%)
Similarity:13/31 - (41%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 EEYFYPRQFYIIGAGPSFNNGTRNSTEPLQY 205
            ||.|..|..:|.|........||||....|:
 Frog    50 EETFGIRSAWISGRSKEDGLWTRNSPGSSQH 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649
hoxa3NP_001120901.1 Homeodomain 165..221 CDD:459649
DUF4074 343..404 CDD:463833
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.