DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and AAH1

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_014258.1 Gene:AAH1 SGDID:S000005085 Length:347 Species:Saccharomyces cerevisiae

Alignment Length:393 Identity:85/394 (22%)
Similarity:142/394 (36%) Gaps:99/394 (25%)


  Fly   140 SILSFRRTPK-EHKCQSQYVLVSD------ERRNSLDRQVYDRNFERLINLYTPVPELE-----Y 192
            |:...:..|| ||....:..|..|      :|.:.:..:.:.::.|.|...|....:|:     |
Yeast     3 SVEFLQELPKCEHHLHLEGTLEPDLLFPLAKRNDIILPEGFPKSVEELNEKYKKFRDLQDFLDYY 67

  Fly   193 PTITRVWDRFQGMFDGLSDALIYLPAFRAYHWQMLEELYNDNVMYTEIRTSFKTLYDASGRTFPR 257
            ...|.|....|..||              ..|...::::...:::.|:      .||....|   
Yeast    68 YIGTNVLISEQDFFD--------------LAWAYFKKVHKQGLVHAEV------FYDPQSHT--- 109

  Fly   258 ERTIHELYALNQKFM----KLHPDF-LGFKVIMAVYRGYELDHLKDIVEVFKKLHQALPHFLVG- 316
            .|.| .:..:.:.|.    |...:| :..|:||.:.|..|.:      |..|.:.:|.|....| 
Yeast   110 SRGI-SIETVTKGFQRACDKAFSEFGITSKLIMCLLRHIEPE------ECLKTIEEATPFIKDGT 167

  Fly   317 FDLVGQEDKGKPL--------YSLLPVL-RDLPPTARLFLHGGETNWFGASTDINLLDAL-LMNT 371
            ...:|.:...||.        |.....| :||..||    |.||.   |.:..::  ||| |:..
Yeast   168 ISALGLDSAEKPFPPHLFVECYGKAASLNKDLKLTA----HAGEE---GPAQFVS--DALDLLQV 223

  Fly   372 TRIGHGYALAKHPILLNAVKSRRIAVELSPISNQVLHLVWDLRNHPGSQFFALDVPVVICNDDPG 436
            |||.||........||:.:...:..:.:.|:||..|.:|..:...|..:|...|||..:.:|||.
Yeast   224 TRIDHGINSQYDEELLDRLSRDQTMLTICPLSNVKLQVVQSVSELPLQKFLDRDVPFSLNSDDPA 288

  Fly   437 FWNAKGLSYDFYYAIMSLAPNNAGLRLLKTLVWNSVRYSTLTEEEQTRAFKILELSWSRFIDDVL 501
            ::.  |...|.|..:....|:           |          :.:|         |.|...:.:
Yeast   289 YFG--GYILDVYTQVSKDFPH-----------W----------DHET---------WGRIAKNAI 321

  Fly   502 EGS 504
            :||
Yeast   322 KGS 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627
adm_rel 25..501 CDD:273620 83/389 (21%)
ADGF 78..493 CDD:238646 81/381 (21%)
AAH1NP_014258.1 aden_deam 10..338 CDD:273619 84/387 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C29731049
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.