DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and YBR284W

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_009843.3 Gene:YBR284W SGDID:S000000488 Length:797 Species:Saccharomyces cerevisiae

Alignment Length:596 Identity:131/597 (22%)
Similarity:202/597 (34%) Gaps:196/597 (33%)


  Fly    15 LQIQAQTALSYEQARQAV----LTAEEELMTGGHTHLNTEEEKVDDIFMEYKLGELAQGFRNAEQ 75
            |.|..|.|||..|....|    |...:|.:.|....|:.||....::..:   |.......|::.
Yeast   150 LTISKQDALSCPQLHSRVAGGYLKPVKEKLFGIRHFLDLEESNTVNLLQD---GNYMTELFNSQI 211

  Fly    76 NAAALHFFK------AKPLIDRSAIFRFLQK-----MPKGSVL-HVHNTASV-SSKWVVDDLSYM 127
            |......|:      .|.:.||| :.||.:|     :.|..|. |:|:...: .||.|.....| 
Yeast   212 NIPTFKEFREDFEWCLKIIRDRS-LSRFSEKRLQYLVNKFPVFQHLHSKEEMRQSKKVPHKDFY- 274

  Fly   128 PGLLRCTTATGQSILSFRRTPKEHKCQSQYVL---VSDERRNSLDR--------------QVYDR 175
                .|.......:||        .|.||:.|   :..:.|...||              |::..
Yeast   275 ----NCRKIDLNLLLS--------GCFSQWQLTEFIWTKLRKEPDRVIHQAFNGSHITLSQLFKV 327

  Fly   176 NFERLINLYTPVPELEYPTITRVWDRFQGMFDGLSDALIYLPAFRAYHWQMLEELYNDNVMYTEI 240
            |||.....:..:..::        |.|...:     .:|||   ..||      |.||.:   ||
Yeast   328 NFEETGQFFNGLKIID--------DSFLEWY-----KVIYL---AKYH------LVNDEM---EI 367

  Fly   241 RTS-----------FKTLYDASG-----------RTF---PRERTIHELYALNQKF-MKLHPD-- 277
            .|.           .||..:...           :||   |:|.:.::|..|:..| ..||.|  
Yeast   368 HTGSHGKQLRYYLIAKTFLEFDNYINGEYLAELLKTFLIKPQEESKYQLCQLSVDFQFYLHYDNS 432

  Fly   278 -----------FLGFKVIMA--------VYRGY-ELDH---LKDIVE----VFKK-------LHQ 308
                       :|....|.:        :.|.| ||.|   :|:..|    :||.       ||:
Yeast   433 DVDNWWMVFANWLNHYNIFSNNIRWNIRISRIYPELYHTGKVKNFQEYLNLIFKPLFNAENYLHK 497

  Fly   309 ALPHFLVGF-------DLVGQED-----KGKPLYSLLPVLRDLPPTARLFLHGGETNWFGASTDI 361
            :|...|:.|       ||..|:.     |.....|.||  :|       :..||:.     .|..
Yeast   498 SLGPILLKFLSQVSSIDLCIQDTDNYIWKNFTAVSCLP--KD-------WTSGGDN-----PTIS 548

  Fly   362 NLLDALLMNTTRIGH-GYALAKHPILLNAVKSRRIAVELSPISNQVLHLVWDLRNHPGSQFFALD 425
            ..:..:.:|.|::.| ..||.::...|.:..|.......|..||.:     :...|..:   .|:
Yeast   549 QYMYYVYVNLTKLNHIRQALHQNTFTLRSSCSPTSMNRTSQFSNTL-----NFTEHTEA---ILN 605

  Fly   426 VPVVICNDDPGF------WNA-KGLSYDFYYA--IMSLAPNNAGLRLLKTLVWNSVRYSTLTEEE 481
            ..::.|.   ||      ||| ..|.|.||.:  .|.:||.|:.:....|::           :|
Yeast   606 NFLLACG---GFLNAENLWNAPPSLVYLFYLSQIPMVVAPLNSIVDSKPTML-----------QE 656

  Fly   482 QTRAFKILELS 492
            |.....:||.|
Yeast   657 QAPTGLVLEPS 667

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 24/93 (26%)
adm_rel 25..501 CDD:273620 125/587 (21%)
ADGF 78..493 CDD:238646 114/530 (22%)
YBR284WNP_009843.3 Add 341..748 CDD:224729 84/389 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.