DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and ampd2b

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_009302285.3 Gene:ampd2b ZFINID:ZDB-GENE-070713-5 Length:830 Species:Danio rerio

Alignment Length:450 Identity:93/450 (21%)
Similarity:164/450 (36%) Gaps:153/450 (34%)


  Fly    62 KLGELA-------QGFRNAEQNAAALHFFKAKPLIDRSAIFRFLQKMPK---GSVLHVHNTASVS 116
            ::.|||       :.|.|..:....:|   |...:::..:.||:::..|   |.::||..     
Zfish   346 EMKELAAQKKVPHRDFYNIRKVDTHIH---ASSCMNQKHLLRFIKRAMKKYPGEIVHVEQ----- 402

  Fly   117 SKWVVDDLSYMPGLLRCTTATGQSILSFRRTPKEHKCQSQYVLVSDERRNSLDRQVYDRN----F 177
                               ..||::...        .:|..:...|...::||... |||    |
Zfish   403 -------------------GRGQTLTEV--------FESMNLTAFDLSVDTLDMHA-DRNTFHRF 439

  Fly   178 ERLINLYTPVPE-LEYPTITRVWDRFQGMFDG------LSDALIYLPAFRAYHWQMLEELYNDNV 235
            ::..:.|.|:.| :......:..:..:|.:.|      ::|               |||....||
Zfish   440 DKFNSKYNPIGESILREIFIKTDNHIEGKYFGHIIKEVMAD---------------LEESKYQNV 489

  Fly   236 MYTEIRTSFKTLYDASGRT------FPRERTIHELYALNQKFMKLHPDFLGFKVIMAVYRGYELD 294
               |:|.|   :|   ||:      ..:....|::|:.|.::            ::.|.|.:::.
Zfish   490 ---ELRLS---IY---GRSRDEWDKLAQWAVTHKVYSDNVRW------------LVQVPRLFDVY 533

  Fly   295 HLKDIVEVFK---------------------KLHQALPHFLVGFDLVGQEDKGKP------LYSL 332
            |.|..:..|:                     :||..|.| :||||.|  :|:.||      |.|.
Zfish   534 HTKKQLSNFQEMLANIFMPLFEVTVNPSSHPELHLFLQH-VVGFDSV--DDESKPEHHIFNLDSP 595

  Fly   333 LPVL---RDLPPTA--RLFLHGGET-----------NWF------GASTDINLLDALLMNTTRIG 375
            .||.   .|.||.:  ..:::...|           |.|      |.:..|:.|.:..|.:..|.
Zfish   596 KPVNWTDEDNPPYSYYLYYMYANMTVLNHLRRQRNMNSFVLRPHCGEAGPIHHLVSGFMLSENIS 660

  Fly   376 HGYALAKHPILLNAVKSRRIAVELSPISNQVLHLVWDLRNHPGSQFFALDVPVVICNDDP 435
            ||..|.|.|:|.......:|.:.:||:||..|.|.:  ..:|..::.:..:.|.:..|||
Zfish   661 HGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSY--HRNPLPEYLSRGLMVSLSTDDP 718

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 9/43 (21%)
adm_rel 25..501 CDD:273620 93/450 (21%)
ADGF 78..493 CDD:238646 88/427 (21%)
ampd2bXP_009302285.3 AMPD 307..803 CDD:238644 93/450 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.