DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and ada

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001011025.1 Gene:ada XenbaseID:XB-GENE-950501 Length:358 Species:Xenopus tropicalis

Alignment Length:315 Identity:68/316 (22%)
Similarity:117/316 (37%) Gaps:72/316 (23%)


  Fly   215 YLP-------AFRAYHWQMLEELYNDNVMYTEIRTSFKTLYDASGRTFPRERTIHELYALNQKFM 272
            |:|       |.:...::.:|....:.|:|.|:|.|...|.::.....|          ..||..
 Frog    67 YMPAIAGDREAIKRIAYEFVEMKAKEGVIYVEVRYSPHFLANSKVEPIP----------WGQKEG 121

  Fly   273 KLHPDFLGFKVIMAVYRGYELDHLK----------------DIVEVFKKLHQALPHFLVGFDLVG 321
            .:.||.:...|...:.:|.:..::|                ::||:.||...   ..:|..||.|
 Frog   122 DITPDEVVDLVNQGLRKGEKAFNIKARSILCCMRHMPSWSTEVVELCKKYQN---DTVVAIDLAG 183

  Fly   322 QEDKGKPLYSLLPVLRDLPPTARLF-----------LHGGETNWFGASTDINLLDAL-LMNTTRI 374
            .|......|         |...:.:           :|.||.   |.|:.:.  :|: ::...||
 Frog   184 DESLNCESY---------PGHRKAYEEAVKCGIHRTVHAGEV---GPSSVVK--EAVEVLKAERI 234

  Fly   375 GHGYALAKHPILLNAVKSRRIAVELSPISNQVLHLVW-DLRNHPGSQFFALDVPVVICNDDPGFW 438
            ||||...:.|.|...:..:.:..|:.|.|:.:..... |...||.:||........:..|||..:
 Frog   235 GHGYHTTEDPNLYKELLEKNMHFEVCPWSSYLTGACHPDFTKHPATQFRKDKANYSLNTDDPLIF 299

  Fly   439 NAKGLSYDFYYAIMSLAPNNAGL--RLLKTLVWNSVRYSTLTEEEQTR-AFKILE 490
               |.:.|..|   |:|..:.|.  ...|.:..|:.:.|.|.|.|:.. .:|:.|
 Frog   300 ---GSTLDVDY---SIAAKHMGFTEEEFKRVNINAAKSSFLPESEKKELLYKLYE 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627
adm_rel 25..501 CDD:273620 68/316 (22%)
ADGF 78..493 CDD:238646 68/316 (22%)
adaNP_001011025.1 ADA 7..346 CDD:238645 67/312 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.