| Sequence 1: | NP_650308.3 | Gene: | Adgf-C / 41680 | FlyBaseID: | FBgn0038173 | Length: | 506 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001002646.1 | Gene: | ada / 436919 | ZFINID: | ZDB-GENE-040718-393 | Length: | 362 | Species: | Danio rerio | 
| Alignment Length: | 454 | Identity: | 90/454 - (19%) | 
|---|---|---|---|
| Similarity: | 148/454 - (32%) | Gaps: | 158/454 - (34%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    73 AEQNAAALHFFKAKPLIDRSAIFRFLQKMPKGSVLHVHNTASVSSKWVVDDLSYMPGLLRCTTAT 137 
  Fly   138 GQSILSFRRTPKEHKCQSQYVLVSDERRNSLDRQVYDRNFERLINLYTPVPELEYPTITRVWDRF 202 
  Fly   203 QGMFDGLSDALI-YLPAFRAYHWQMLEELYNDNVMYTEIRTSFKTLYDASGRTFPRERTIHELYA 266 
  Fly   267 LNQKFMKLHPDFLGFKVIMAVYRGYE----------------LDHL----KDIVEVFKKLHQALP 311 
  Fly   312 HFLVGFDLVGQEDKGKPLYSLLPVLRDLPPTARLF-----------LHGGETNWFGASTDINLLD 365 
  Fly   366 AL-LMNTTRIGHGYALAKHPILLNAVKSRRIAVELSPISNQVLHLVW-DLRNHPGSQFFALDVPV 428 
  Fly   429 VICNDDPGFWNAKGLSYDFYYAIMSLAPNNAGLRLLKTLVWNSVRYSTLTEEEQTRAFKILELS 492 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Adgf-C | NP_650308.3 | A_deaminase_N | 5..98 | CDD:285627 | 6/24 (25%) | 
| adm_rel | 25..501 | CDD:273620 | 90/454 (20%) | ||
| ADGF | 78..493 | CDD:238646 | 87/449 (19%) | ||
| ada | NP_001002646.1 | ADA | 11..350 | CDD:238645 | 85/437 (19%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG1816 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||