DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and ada

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001002646.1 Gene:ada ZFINID:ZDB-GENE-040718-393 Length:362 Species:Danio rerio

Alignment Length:454 Identity:90/455 (20%)
Similarity:148/455 (33%) Gaps:158/455 (35%)


  Fly    73 AEQNAAALHFFKAKPLIDRSAIFRFLQKMPKGSVLHVHNTASVSSKWVVDDLSYMPGLLRCTTAT 137
            ||.|        .||..|:          ||.. ||||...::..|.|:|               
Zfish     2 AEMN--------GKPAFDK----------PKVE-LHVHLDGAIRLKTVLD--------------- 32

  Fly   138 GQSILSFRRTPKEHKCQSQYVLVSDERRNSLDRQVYDRNFERLINLYTPVPELEYPTITRVWDRF 202
                                  |:..|..||...: :...:.|..:..|.      |:|    .|
Zfish    33 ----------------------VAKRRGISLPVSM-EEELKELCTVNEPA------TLT----EF 64

  Fly   203 QGMFDGLSDALI-YLPAFRAYHWQMLEELYNDNVMYTEIRTSFKTLYDASGRTFPRERTIHELYA 266
            .|.|......:. ...|.:...::.:|....:.|:|.|.|.|...|.:......|          
Zfish    65 LGKFSHFMHVIAGDREAIKRIAYEFVETKAKEGVIYVEARYSPHFLANKGVEPLP---------- 119

  Fly   267 LNQKFMKLHPDFLGFKVIMAVYRGYE----------------LDHL----KDIVEVFKKLHQALP 311
            .:||...:.||    .|:..|.:|::                :.|:    .::||:.||.|:   
Zfish   120 WDQKPGDITPD----DVVDLVNQGFKEGEQAFKTKARSILCCMRHMPNWSMEVVELCKKFHK--- 177

  Fly   312 HFLVGFDLVGQEDKGKPLYSLLPVLRDLPPTARLF-----------LHGGETNWFGASTDINLLD 365
            ..:|..||.|.|......|         |...:.|           :|.||.   |.::.:.  :
Zfish   178 DGVVAIDLAGDESMNCESY---------PGHKKAFEEAVRSNVHRTVHAGEV---GPASVVR--E 228

  Fly   366 AL-LMNTTRIGHGYALAKHPILLNAVKSRRIAVELSPISNQVLHLVW-DLRNHPGSQFFALDVPV 428
            |: ::...||||||...:...|...:..:.:..|:.|:|:::..... |...||...|.......
Zfish   229 AVEVLKAERIGHGYHTLEDQNLYKQLLHQNMHFEMCPVSSRLTGACEPDFTKHPLITFKKDKANY 293

  Fly   429 VICNDDPGFWNAKGLSYDFYYAIMSLAPNNAGLRLLKTLVWNSVRYSTLTEEEQTRAFKILELS 492
            .:..|||..:|:. |:.|  |.::.                   :|...||||    ||.|.::
Zfish   294 SLNTDDPTIFNST-LNSD--YEVVQ-------------------KYMDFTEEE----FKRLNIN 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 6/25 (24%)
adm_rel 25..501 CDD:273620 90/455 (20%)
ADGF 78..493 CDD:238646 87/450 (19%)
adaNP_001002646.1 ADA 11..350 CDD:238645 85/438 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.