DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and Adgf-D

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_524345.2 Gene:Adgf-D FlyBaseID:FBgn0038172 Length:502 Species:Drosophila melanogaster

Alignment Length:499 Identity:222/500 (44%)
Similarity:311/500 (62%) Gaps:10/500 (2%)


  Fly     4 LLMFVVLLTAQLQIQAQTALSYEQARQAVLTAEEELMTGGHTHLNTEEEKVDDIFMEYKLGELAQ 68
            |:..|||||..:|   .|.|.||..|:.::.||.....||:..|:::|||.:.|.|..|..|:|:
  Fly     9 LVATVVLLTGSVQ---ATDLPYETLREQIMEAERVASLGGNIWLSSDEEKANSILMNAKRAEIAE 70

  Fly    69 GFRNAEQNAAALHFFKAKPLIDRSAIFRFLQKMPKGSVLHVHNTASVSSKWVVDDLSYMPGLLRC 133
            |.:..|:.|.|:|||:.:..:.:|.:||.:||:|||:.||.|||..|:|:|::.:|:....|..|
  Fly    71 GLKTPEKYAPAMHFFQGRQYVRQSEVFRMIQKIPKGAFLHGHNTGMVTSRWIIQNLTTTNNLYTC 135

  Fly   134 TTATGQSILSFRRTPKEHKCQSQYVLVSDERRNSLDRQVYDRNFERLINLYTPVPELEYPTITRV 198
            ....|..:.::    .:..|.|:...|..||.|:.||..|:|..|:.||::.|.||...|...::
  Fly   136 RNVDGLLVFTY----DQSGCHSEVQNVCTERINAEDRGKYERQLEKHINMHGPRPEALLPNRKKI 196

  Fly   199 WDRFQGMFDGLSDALIYLPAFRAYHWQMLEELYNDNVMYTEIRTSFKTLYDASGRTFPRERTIHE 263
            |:||:.:|..:.....|.|.:.|||.:|||||..||::|.|||.|...|||.:.||.......:|
  Fly   197 WERFENIFTTVDRLYKYRPTYCAYHKRMLEELCEDNIIYAEIRASLSPLYDDNNRTLSTLEVANE 261

  Fly   264 LYALNQKFMKLHPDFLGFKVIMAV-YRGYELDHLKDIVEVFKKLHQALPHFLVGFDLVGQEDKGK 327
            |..:.::|...|.||:|.|||.|. .|..|.:.|:.|. .||:||.|.|:|::||||:||||.|:
  Fly   262 LERIVEEFKAKHHDFIGVKVIYAKRNRASEEEMLRRIT-TFKQLHHAKPNFVIGFDLIGQEDTGE 325

  Fly   328 PLYSLLPVLRDLPPTARLFLHGGETNWFGASTDINLLDALLMNTTRIGHGYALAKHPILLNAVKS 392
            ||...:..|.|||.||..|.|.|||||.| .||.|::||:|:||.||||.:||.|||.|.:.:|.
  Fly   326 PLNRYINQLSDLPSTANYFFHAGETNWNG-RTDWNMMDAILLNTKRIGHAFALPKHPQLWSTIKK 389

  Fly   393 RRIAVELSPISNQVLHLVWDLRNHPGSQFFALDVPVVICNDDPGFWNAKGLSYDFYYAIMSLAPN 457
            |.||:|::|||||||..||||||||.|...|.:.|:||.:||||.|.|||||||||||.|:|||.
  Fly   390 RNIAIEVNPISNQVLGFVWDLRNHPASFLIAENFPIVISSDDPGVWGAKGLSYDFYYAFMALAPA 454

  Fly   458 NAGLRLLKTLVWNSVRYSTLTEEEQTRAFKILELSWSRFIDDVL 501
            :|.||.||.|..||::|:.||.:|:.:..::.:..|..||.:||
  Fly   455 DADLRFLKQLALNSIKYAVLTSDERRKINRVFQRKWQEFIANVL 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 34/93 (37%)
adm_rel 25..501 CDD:273620 212/477 (44%)
ADGF 78..493 CDD:238646 189/416 (45%)
Adgf-DNP_524345.2 A_deaminase_N 4..100 CDD:285627 35/94 (37%)
adm_rel 27..498 CDD:273620 212/477 (44%)
ADGF 80..490 CDD:238646 189/416 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25621599
eggNOG 1 0.900 E1_COG1816
Homologene 1 1.000 H81852
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D197912at33208
OrthoFinder 1 1.000 FOG0003139
orthoMCL 1 0.900 OOG5_130834
Panther 1 1.100 P PTHR11409
RoundUp 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.