DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and Ada

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_649866.1 Gene:Ada FlyBaseID:FBgn0037661 Length:337 Species:Drosophila melanogaster

Alignment Length:392 Identity:91/393 (23%)
Similarity:153/393 (39%) Gaps:78/393 (20%)


  Fly    96 RFLQKMPKGSVLHVHNTASVSSKWVVDDLSYMPGLLRCTTATGQSILSFRRTPKEHKCQSQYVLV 160
            :||:.:||.. ||.|...|:..|.:.|              .|:.:..       ..|:....|.
  Fly     3 QFLKGLPKVE-LHAHLNGSLGIKSLCD--------------LGERLYG-------TSCKDFLKLC 45

  Fly   161 SDERRNSLDRQVYDRNFERLINLYTPVPELEYPTITRVWDRFQGMFDGLSDALIYLPAFRAYHWQ 225
            :...|       ::::.:.....:..|.||   |.||...||....                   
  Fly    46 AHFSR-------FEKDMDACFEKFAFVHEL---TSTREGLRFATEL------------------- 81

  Fly   226 MLEELYNDNVMYTEIRTSFKTLYDASGRTFPRERTIHELYALNQKFMKLHPDFLGFKVIMAVYRG 290
            .:.:...|||.|.|:||:.|...:.|.|.: .:..|..:.|.::.:    |: :..|::.::.|.
  Fly    82 AIRDFAEDNVQYVEMRTTPKANENYSRRDY-LQIVIDAIKAASETY----PE-ITVKLLPSINRA 140

  Fly   291 YELDHLKDIVEVFKKLHQALPHFLVGFDLVGQEDKGKPLYSLLPVL---RDLPPTARLFLHGGET 352
            ..:|..::.|.:..:|.:|.|:.::|.||.|...||: .....|:|   ||  ...:|.:|..| 
  Fly   141 EPVDVAEETVSLAVELARAHPNLILGIDLSGNPGKGR-FSDFAPILAQARD--KGLKLAIHCAE- 201

  Fly   353 NWFGASTDINLLDALLMNTTRIGHGYALAKHPILLNAVKSRRIAVELSPISNQVLHLVWDLRNHP 417
                ......:.:.|....:|.|||..|.  |..:..:|.|.||:|....||.....|..|..|.
  Fly   202 ----IENPSEVKEMLHFGMSRCGHGTFLT--PEDIGQLKQRNIAIECCLTSNVKSGTVPSLEEHH 260

  Fly   418 GSQFFALDVPVVICNDDPGFWNAKGLSYDFYYAIMSLAPNNAGLRLLK--TLVWNSVRYSTLTEE 480
            ..:....|.|.|||.||.|.::.. |:.:|.     :|....||...:  .|...:|.:|..:|:
  Fly   261 LKRIMEADAPKVICTDDSGVFDTT-LTKEFL-----IAAETFGLTREQCIDLTLEAVHHSFASEQ 319

  Fly   481 EQ 482
            ||
  Fly   320 EQ 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 1/2 (50%)
adm_rel 25..501 CDD:273620 91/393 (23%)
ADGF 78..493 CDD:238646 91/393 (23%)
AdaNP_649866.1 ADA_AMPD 8..327 CDD:238250 89/388 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C28351890
eggNOG 1 0.900 E1_COG1816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11409
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.