DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and Adgf-A

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_524130.1 Gene:Adgf-A FlyBaseID:FBgn0036752 Length:553 Species:Drosophila melanogaster

Alignment Length:483 Identity:182/484 (38%)
Similarity:267/484 (55%) Gaps:7/484 (1%)


  Fly    24 SYEQARQAVLTAEEELMTGGHTHLNTEEEKVDDIFMEYKLGELAQGFRNAEQNAAALHFFKAKPL 88
            :|:..|.|....||....|....||:.|.|.::..|:.||.|..:|.........:.|.|.....
  Fly    65 TYKTLRSAFFRYEESRSLGHDLDLNSREIKANETIMKAKLKEFDEGLVTPHLFKPSQHIFDVLDG 129

  Fly    89 IDRSAIFRFLQKMPKGSVLHVHNTASVSSKWVVDDLSYMPGLLRCTT--ATGQSILSFRRTPKEH 151
            |..:.:|:.|:|||||:|||.|:||..|:..:: :|:|...|..|..  ....|.|.|.:...:.
  Fly   130 IRNTDLFKLLKKMPKGAVLHAHDTALCSTAAII-NLTYYEHLWSCQQDGDLSASALRFSKDKPQA 193

  Fly   152 KCQSQYVLVSDERRNSLDRQVYDRNFERLINLYTPVPELEYPTITRVWDRFQGMFDGLSDALIYL 216
            .....:.|:||.|......:|.|...||| .||   |..::......|..|..:|:.|...::|.
  Fly   194 LSDCDWSLLSDVRAKYGADKVDDYLAERL-TLY---PTKKFEDNNAAWSTFMSIFNLLDGLVMYA 254

  Fly   217 PAFRAYHWQMLEELYNDNVMYTEIRTSFKTLYDASGRTFPRERTIHELYALNQKFMKLHPDFLGF 281
            |.:..|:::.|||.|.|.|:|.|.|:...||||..|..|....|:.......:||.:.||||:|.
  Fly   255 PVWADYYYKALEEFYEDGVLYLEFRSVVPTLYDMDGTEFTPMDTVRIYVETLEKFKEAHPDFIGS 319

  Fly   282 KVIMAVYRGYELDHLKDIVEVFKKLHQALPHFLVGFDLVGQEDKGKPLYSLLPVLRDLPPTARLF 346
            ::|.|..|....:.:...::..|::.:..|.|:.||||||||:.|:||...:..|..:|.....:
  Fly   320 RMIYAPIRYTNAEGVTGYIQTLKQIKEKYPEFVAGFDLVGQEEMGRPLRDFVDELLSIPDDIDFY 384

  Fly   347 LHGGETNWFGASTDINLLDALLMNTTRIGHGYALAKHPILLNAVKSRRIAVELSPISNQVLHLVW 411
            .|.|||||||::.|.||:||:|:.|.|||||:.|.|||::|:.:|...:|:|::|||||||.||.
  Fly   385 FHAGETNWFGSTVDENLIDAILLGTKRIGHGFGLVKHPVVLDMLKKLNVAIEVNPISNQVLQLVS 449

  Fly   412 DLRNHPGSQFFALDVPVVICNDDPGFWNAKGLSYDFYYAIMSLAPNNAGLRLLKTLVWNSVRYST 476
            |.||||.|.|||...||||.:|||.||.|..|::|||.|.:.:|..::.|||||.|..||::||:
  Fly   450 DFRNHPCSHFFADGYPVVISSDDPSFWKATPLTHDFYIAFLGIASQHSDLRLLKKLALNSIQYSS 514

  Fly   477 LTEEEQTRAFKILELSWSRFIDDVLEGS 504
            ||.:.|..|.:..::.|.:||.||.:.|
  Fly   515 LTGDAQFEALEKWQVKWDQFIADVNDRS 542

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 19/74 (26%)
adm_rel 25..501 CDD:273620 181/478 (38%)
ADGF 78..493 CDD:238646 161/417 (39%)
Adgf-ANP_524130.1 A_deaminase_N 54..139 CDD:285627 19/74 (26%)
adm_rel 66..538 CDD:273620 180/477 (38%)
ADGF 119..531 CDD:238646 161/417 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25622553
eggNOG 1 0.900 E1_COG1816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D197912at33208
OrthoFinder 1 1.000 FOG0003139
orthoMCL 1 0.900 OOG5_130834
Panther 1 1.100 P PTHR11409
RoundUp 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.