DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and ada2a

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001028889.2 Gene:ada2a ZFINID:ZDB-GENE-030902-4 Length:503 Species:Danio rerio

Alignment Length:478 Identity:182/479 (38%)
Similarity:253/479 (53%) Gaps:19/479 (4%)


  Fly    29 RQAVLTAEEELMTGGHTHLNTEEEKVDDIFMEYKLGELAQGFRNAEQNAAALHFFKAKPLIDRSA 93
            |.|::..|....|||...||..|:.:|.     ||.:|.|....|.|...::||||||.|||:|.
Zfish    31 RDALIGLEASRRTGGDITLNEREKLLDG-----KLQKLKQHDMEAGQFPPSMHFFKAKRLIDQSP 90

  Fly    94 IFRFLQKMPKGSVLHVHNTASVSSKWVVDDLSYMPGLLRCTT--ATGQSILSFRRTPKEHKCQSQ 156
            :|..:||||||:.||||:.|.||..|:|.:::|......|.|  .|.|.|.|.........| |.
Zfish    91 VFNLIQKMPKGAALHVHDFAMVSVDWLVKNVTYRENCYVCFTDKQTVQFIFSSGPPASSSHC-SS 154

  Fly   157 YVLVSDERRNSLDRQVYDRNFERLINLYTPVPELEYPTITRVWDRFQGMFDGLSDALIYLPAFRA 221
            :.|:...|....:....|.:|.|.:.|:|..|:..||....||:||:.:|......:.|.|.|:.
Zfish   155 WTLLRSLREKIKNTTELDNSFIRNLTLFTEDPDRAYPNQDTVWERFEQVFLVAYGLVTYAPVFKD 219

  Fly   222 YHWQMLEELYNDNVMYTEIRTSFKTLYDASGRTFPRERTIHELYALNQKFMKLHPDFLGFKVIMA 286
            |.::.|.:.|.||:||.|||......|:..||...::.::.....:..:|.|.||||:|.:||..
Zfish   220 YLYEGLRQFYEDNIMYVEIRALLPQTYELDGRLNDKDWSMAACQEVVNQFKKHHPDFIGARVIFT 284

  Fly   287 VYRGYELDHLKDIVEVFKKLHQALPHFLVGFDLVGQEDKGKPLYSLLPVLR-------DLPPTAR 344
            |:|..........||....|.:..|..:.|||.|||||.|:||:.....|.       :||    
Zfish   285 VHRKINATEAVKTVEEAMILRRNFPDVMAGFDFVGQEDLGRPLWYFKDALSLPEDKGFNLP---- 345

  Fly   345 LFLHGGETNWFGASTDINLLDALLMNTTRIGHGYALAKHPILLNAVKSRRIAVELSPISNQVLHL 409
            .|.|.|||:..|...|.||:||||.||||||||:|||:||::....:...:.:|:.|||||||.|
Zfish   346 YFFHAGETDSQGTDVDQNLMDALLFNTTRIGHGFALARHPVVKEMARKMYVPIEVCPISNQVLKL 410

  Fly   410 VWDLRNHPGSQFFALDVPVVICNDDPGFWNAKGLSYDFYYAIMSLAPNNAGLRLLKTLVWNSVRY 474
            |.|||:||.:...|...|:||.:|||..:.|..||:|||.|.|.....:..|..||.|..||:||
Zfish   411 VSDLRDHPAAVLMAEGHPLVISSDDPAVFGATALSHDFYEAFMGFGGMSFNLGTLKELALNSLRY 475

  Fly   475 STLTEEEQTRAFKILELSWSRFI 497
            |||:.:.:..|...|.:.|.:|:
Zfish   476 STLSSQRKEEAIDALLVKWDKFV 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 27/69 (39%)
adm_rel 25..501 CDD:273620 182/479 (38%)
ADGF 78..493 CDD:238646 164/424 (39%)
ada2aNP_001028889.2 A_deaminase_N <29..95 CDD:285627 27/69 (39%)
adm_rel 30..502 CDD:273620 182/479 (38%)
ADGF 75..494 CDD:238646 164/424 (39%)
Substrate binding. {ECO:0000250} 197..204 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C26922229
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H81852
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D197912at33208
OrthoFinder 1 1.000 FOG0003139
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130834
Panther 1 1.100 O PTHR11409
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.