DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and Adgf-E

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_610977.1 Gene:Adgf-E FlyBaseID:FBgn0033952 Length:539 Species:Drosophila melanogaster

Alignment Length:506 Identity:166/507 (33%)
Similarity:263/507 (52%) Gaps:21/507 (4%)


  Fly     6 MFVVLLTAQLQIQAQTALSYEQARQAVLTAEEELMTGGHTHLNTEEEKVDDIFMEYKLGELAQGF 70
            |.::.:.....::..|...|...|:...:.|.....|....|...|...:::.|..|..|..:|.
  Fly    33 MTLLEMLGTTNLRKSTPKDYRILREIFNSFERYSGVGNDIQLTLPERAANELIMCEKKREYEKGI 97

  Fly    71 RNAEQNAAALHFFKAKPLIDRSAIFRFLQKMPKGSVLHVHNTASVSSKWVVDDLSYMPGLLRCTT 135
            .:..:.|...|.|:....:.:|.:|:.|::||||:.|..|:|:..||: ||.:::|...|..|||
  Fly    98 MDPSKFAPGHHIFQVLTKVKKSPLFQILRRMPKGAALKAHDTSMCSSR-VVIEITYRDNLWVCTT 161

  Fly   136 ATGQSILSFR---RTPKEHKCQSQYVLVSDER-----RNSLDRQVYDRNFERLINL-YTPVPELE 191
            ..|..:..||   ..||:         ||.|.     ...|.....:.|..:.:.: ::..|...
  Fly   162 QNGCRVEEFRFAKDKPKD---------VSFENGEWQPMEKLRELRGEENLRKYLQMRFSMYPLAS 217

  Fly   192 YPTITRVWDRFQGMFDGLSDALI-YLPAFRAYHWQMLEELYNDNVMYTEIRTSFKTLYDASGRTF 255
            :.|....|....|:| ||.|.|: |.|.:..|::..|:|.|.|.|.|.|:|:....||...|...
  Fly   218 FTTNAHAWRHMMGIF-GLLDGLLQYAPVWGDYYYNALKEFYADGVQYLEVRSVLPQLYSLDGSRM 281

  Fly   256 PRERTIHELYALNQKFMKLHPDFLGFKVIMAVYRGYELDHLKDIVEVFKKLHQALPHFLVGFDLV 320
            |:..|:.......::|.|.||.|:..|:|.|..|..:.:.:.:.::...:|::..|.|:||||||
  Fly   282 PKRETVQIYKDTLERFKKEHPGFIDSKLIYAPIRHVQPELVGEYIKECTELNKEFPSFVVGFDLV 346

  Fly   321 GQEDKGKPLYSLLPVLRDLPPTARLFLHGGETNWFGASTDINLLDALLMNTTRIGHGYALAKHPI 385
            ||||.|.||.:....|..||.....:.|.|:|||:|:..|.|||||:::.|.||||||.:.|||:
  Fly   347 GQEDVGHPLSNFAAELLKLPDHIHFYFHAGQTNWYGSHVDQNLLDAIVLGTKRIGHGYTITKHPV 411

  Fly   386 LLNAVKSRRIAVELSPISNQVLHLVWDLRNHPGSQFFALDVPVVICNDDPGFWNAKGLSYDFYYA 450
            |:...|...||:|:.|:|||||.|..|.|:||.:...|.:||:||.:..||||.|..||:|||.|
  Fly   412 LMRLAKYLNIALEVCPVSNQVLQLGSDYRSHPAATLIAENVPMVIASGSPGFWRAAPLSHDFYMA 476

  Fly   451 IMSLAPNNAGLRLLKTLVWNSVRYSTLTEEEQTRAFKILELSWSRFIDDVL 501
            .:.:||.||.|:.||....||::||:|.:|.:..|.:..:..|.:::::::
  Fly   477 FLGIAPMNADLKFLKRTAKNSIKYSSLKDEAKAEAMEKWKKQWDKWVENIV 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 17/92 (18%)
adm_rel 25..501 CDD:273620 164/486 (34%)
ADGF 78..493 CDD:238646 152/425 (36%)
Adgf-ENP_610977.1 A_deaminase_N 46..125 CDD:285627 16/79 (20%)
adm_rel 52..527 CDD:273620 164/486 (34%)
ADGF 105..519 CDD:238646 152/425 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25622151
eggNOG 1 0.900 E1_COG1816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003139
orthoMCL 1 0.900 OOG5_130834
Panther 1 1.100 P PTHR11409
RoundUp 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.