DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and AMPD1

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_000027.2 Gene:AMPD1 HGNCID:468 Length:780 Species:Homo sapiens

Alignment Length:565 Identity:118/566 (21%)
Similarity:193/566 (34%) Gaps:198/566 (35%)


  Fly     7 FVVLLTAQLQIQAQTALSYEQARQAVLTAEEELMTGGHTHLNTEEEKVDDIFMEYKLGELA---- 67
            |::.|.||..::     :|...|...|:::.::    |..||..:|          |.||.    
Human   279 FLLALIAQGPVK-----TYTHRRLKFLSSKFQV----HQMLNEMDE----------LKELKNNPH 324

  Fly    68 QGFRNAEQNAAALHFFKAKPLIDRSAIFRFLQKMPKGSVLHVHNTASVSSKWVVDDLSYMPGLLR 132
            :.|.|..:....:|   |...:::..:.||::|                        ||.....|
Human   325 RDFYNCRKVDTHIH---AAACMNQKHLLRFIKK------------------------SYQIDADR 362

  Fly   133 CTTATGQSILSFRRTPKEHKCQSQYVLVSDERRNSLD----RQVYDRNFERLINLYTPVPELEYP 193
            ...:|.:..|:.:....:.| ...|.|..|    |||    ||.:.| |::..:.|.||      
Human   363 VVYSTKEKNLTLKELFAKLK-MHPYDLTVD----SLDVHAGRQTFQR-FDKFNDKYNPV------ 415

  Fly   194 TITRVWDRFQGMFDGLSDALIYLPAFRAYHWQMLEELY--NDNVMYTEIRTSFKTLYDASGRTFP 256
                          |.|:               |.:||  .||.:..|.   |.|:....|....
Human   416 --------------GASE---------------LRDLYLKTDNYINGEY---FATIIKEVGADLV 448

  Fly   257 RERTIH-----ELYALN-QKFMKLHPDFLGFKV-------IMAVYRGYELDHLKDIVEVFKKL-- 306
            ..:..|     .:|..: .::.||...|:..::       ::.|.|.|::...|:.:..|.|:  
Human   449 EAKYQHAEPRLSIYGRSPDEWSKLSSWFVCNRIHCPNMTWMIQVPRIYDVFRSKNFLPHFGKMLE 513

  Fly   307 ------------HQALPHF------LVGFDLVGQEDK----------GKP--------------- 328
                        .||.|..      :.|||.|..|.|          .||               
Human   514 NIFMPVFEATINPQADPELSVFLKHITGFDSVDDESKHSGHMFSSKSPKPQEWTLEKNPSYTYYA 578

  Fly   329 --LYSLLPVLRDLPPTARL--FL---HGGETNWFGASTDINLLDALLMNTTRIGHGYALAKHPIL 386
              :|:.:.||..|.....:  ||   |.||.   ||.|  :|:.|.:: ...|.||..|.|.|:|
Human   579 YYMYANIMVLNSLRKERGMNTFLFRPHCGEA---GALT--HLMTAFMI-ADDISHGLNLKKSPVL 637

  Fly   387 LNAVKSRRIAVELSPISNQVLHLVWDLRNHPGSQFFALDVPVVICNDDPGFWNAKGLSYDF---- 447
            .......:|.:.:||:||..|.|  :...:|...|....:.:.:..|||       :.:.|    
Human   638 QYLFFLAQIPIAMSPLSNNSLFL--EYAKNPFLDFLQKGLMISLSTDDP-------MQFHFTKEP 693

  Fly   448 ---YYAIMSLAPNNAGLRLLKT-----LVWNSVRYSTLTEEEQTR 484
               .|||.      |.:..|.|     :..|||....::.||:.:
Human   694 LMEEYAIA------AQVFKLSTCDMCEVARNSVLQCGISHEEKVK 732

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 20/95 (21%)
adm_rel 25..501 CDD:273620 114/548 (21%)
ADGF 78..493 CDD:238646 102/491 (21%)
AMPD1NP_000027.2 PLN03055 164..775 CDD:178613 118/566 (21%)
AMPD 273..769 CDD:238644 118/566 (21%)
Substrate binding. {ECO:0000250} 407..412 0/5 (0%)
Substrate binding. {ECO:0000250} 683..686 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.