DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and C44B7.12

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_871955.2 Gene:C44B7.12 WormBaseID:WBGene00016632 Length:388 Species:Caenorhabditis elegans

Alignment Length:426 Identity:93/427 (22%)
Similarity:151/427 (35%) Gaps:129/427 (30%)


  Fly    50 EEEKVDDIFMEYKLGELAQGFRNAEQNAAALHFFKAKPLIDRSAIFRFLQKMPKGSVLHVHNTAS 114
            |.:|.:|.|::.:|.|::                   ||:....:..| :.|||.. ||.|.:.|
 Worm    28 ETDKKNDEFLDTELDEVS-------------------PLVIDDDMTEF-KNMPKVE-LHAHLSGS 71

  Fly   115 VSSKWVVDDLSYMPGLLRCTTATGQSILSFRRTPKEHKCQSQYVLVSDERRNSLDRQVYDRNFER 179
            :|.:.:                                   :.::.|||.|           .|.
 Worm    72 LSPETI-----------------------------------KLIMESDETR-----------AEE 90

  Fly   180 LINLYTPVPELEYPTITRVWDRFQGMFD--GLSDALIYLP-AFRAYHWQMLEELYNDNVMYTEIR 241
            ::..|    :||.|      :...|:||  .:..|::..| |.|....|.::|...||.:|.|:|
 Worm    91 IMKKY----KLEKP------ENMTGVFDCFPVIHAILRKPEAIRIAIRQTIKEFEEDNCVYLELR 145

  Fly   242 TS-----FKTL----------YDASGRTFPRERTIHELYALNQKFMKLHPDFLGFKVIMAVYRGY 291
            ||     |.|.          ::|:...|||.:|.                     :|:::.|..
 Worm   146 TSPKETDFMTYEDYLQVCIESFEAAKHEFPRIKTF---------------------LIVSLDRRM 189

  Fly   292 ELDHLKDIVEVFKKLHQALPHFLVGFDLVGQED-KGKPLYSLLPVLRDLPPTARLFLHGGETNWF 355
            ..:....|:.:..:..|. .:.:||.:|.|... .|:.|..|.       ..||.| ||......
 Worm   190 PFETAAHILGLIGEAQQR-TNVIVGVELSGDPHLDGRRLLKLF-------VAARRF-HGLGITIH 245

  Fly   356 GASTDINLLDA---LLMNTTRIGHGYALAKHPILLNAVKSRRIAVELSPISNQVLHLVWDLRNHP 417
            .|....|:.|.   |.:...|||||..|...|.........:|.:|:...||.......:.||..
 Worm   246 LAEVLQNMADVEDYLNLRPDRIGHGTFLHTDPYTEYLTNKYKIPLEICLSSNVYSKTTTNYRNSH 310

  Fly   418 GSQFFALDVPVVICNDDPGFWNAKGLSYDFYYAIMS 453
            .:.:....|||.||.||.|......|:.::|.|.::
 Worm   311 FNYWRKRGVPVFICTDDKGVIPGATLTEEYYKAAIT 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 9/48 (19%)
adm_rel 25..501 CDD:273620 93/427 (22%)
ADGF 78..493 CDD:238646 87/399 (22%)
C44B7.12NP_871955.2 ADA_AMPD 59..379 CDD:238250 84/376 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.