DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and Ada

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_569083.1 Gene:Ada RGDID:2031 Length:352 Species:Rattus norvegicus

Alignment Length:346 Identity:68/347 (20%)
Similarity:124/347 (36%) Gaps:65/347 (19%)


  Fly   178 ERLINLYTPVPELEYPTITRVWDRFQGMFDGLSDALIYLPAFRAYHWQMLEELYNDNVMYTEIRT 242
            |.|.|:......|..|.....:|.:.....|..:|:      :...::.:|....:.|:|.|:|.
  Rat    44 EGLRNIIGMDKPLSLPDFLAKFDYYMPAIAGCREAI------KRIAYEFVEMKAKEGVVYVEVRY 102

  Fly   243 SFKTLYDASGRTFP-----RERTIHELYALNQKFMKLHPDFLGFKV--IMAVYRGYELDHLKDIV 300
            |...|.::.....|     .:.|..|:..|..:.::......|.||  |:...| ::.....:::
  Rat   103 SPHLLANSKVDPIPWNQAEGDLTPDEVVDLVNQGLQEGEQAFGIKVRSILCCMR-HQPSWSPEVL 166

  Fly   301 EVFKKLHQALPHFLVGFDLVGQED-KGKPLYSLLPVLRDLPPTARLF-----------LHGGETN 353
            |:.||.||..   :|..||.|.|. :|..|:         |.....:           :|.||. 
  Rat   167 ELCKKYHQKT---VVAMDLAGDETIEGSSLF---------PGHVEAYEGAVKDGIHRTVHAGEV- 218

  Fly   354 WFGASTDINLLDALLMNTTRIGHGYALAKHPILLNAVKSRRIAVELSPISN--------QVLHLV 410
               .|.::......::.|.|:||||...:...|.|.:....:..|:.|.|:        :..|.|
  Rat   219 ---GSAEVVREAVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWNPKTTHAV 280

  Fly   411 WDLRNHPGSQFFALDVPVVICNDDPGFWNAKGLSYDFYYAIMSLAPNNAGLRLLKTLVWNSVRYS 475
            ...::...:.....|.|::       |.:.....|......|......     .|.|..|:.:.|
  Rat   281 VRFKDDQANYSLNSDDPLI-------FKSTVDTDYQMVKKDMGFTEEE-----FKRLNINAAKSS 333

  Fly   476 TLTEEEQTRAFKILELSWSRF 496
            .|.|:|:.   ::||..:..:
  Rat   334 FLPEDEKK---ELLERLYKEY 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627
adm_rel 25..501 CDD:273620 68/347 (20%)
ADGF 78..493 CDD:238646 68/342 (20%)
AdaNP_569083.1 metallo-dependent_hydrolases 9..347 CDD:294200 68/341 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.