DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and ada2

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_017944930.1 Gene:ada2 XenbaseID:XB-GENE-6258151 Length:271 Species:Xenopus tropicalis

Alignment Length:413 Identity:113/414 (27%)
Similarity:150/414 (36%) Gaps:174/414 (42%)


  Fly   104 GSVLHVHNTASVSSKWVVDDLSYMPGLLRCTTATGQSILSFRRTPKEHKCQSQYVLVSDERRNSL 168
            |:.||:|:.|.:|..|:|.:.:||.....|.|..|.....|.:                      
 Frog    14 GAALHLHDFAILSVDWLVKNATYMQDCYICFTRDGGVRFLFSK---------------------- 56

  Fly   169 DRQVYDRNFERLINLYTPVPELEYPTITRVWDRFQGMF-DGLSDALIYLPAFRAYHWQMLEELYN 232
                             |.|              .||. .|.|:            |.:||    
 Frog    57 -----------------PAP--------------VGMLPPGCSE------------WVLLE---- 74

  Fly   233 DNVMYTEIRTSFKTLYDASGRTFPRERTIHELYALNQKFMKLHPDFLGFKVIMAVYRGYELDHLK 297
                                                                  .||        
 Frog    75 ------------------------------------------------------TYR-------- 77

  Fly   298 DIVEVFKKLHQALPHFLVGFDLVGQEDKGKP-------LY----SLLPVLRDLPPTARLFLHGGE 351
                  |||..           |.:.|||..       ||    ||||              |..
 Frog    78 ------KKLGD-----------VTEFDKGNKISFGLFMLYASWLSLLP--------------GSH 111

  Fly   352 TNWFGASTDINLLDALLMNTTRIGHGYALAKHPILLNAVKSRRIAVELSPISNQVLHLVWDLRNH 416
            |:|.|...|.|:|||||:|||||||||||.|||:..|......:.:|:.|||||||.||.|||||
 Frog   112 TDWQGKDVDENVLDALLLNTTRIGHGYALLKHPVARNLSLKMEVPLEICPISNQVLLLVSDLRNH 176

  Fly   417 PGSQFFALDVPVVICNDDPGFWNAKGLSYDFYYAIMSLAPNNAGLRLLKTLVWNSVRYSTLTEEE 481
            |.:...|...|:|:.:|||..:.|:|||||||..:|.:....|.||.||.|..||::||.|::|.
 Frog   177 PAAVLMAEGHPLVVSSDDPSIFGAQGLSYDFYEVVMGIGGAKADLRTLKKLAENSIKYSALSKEG 241

  Fly   482 QTRAFKILELSWSRFIDDVLEGS 504
            :.:..:|.:..|.:||:|:...|
 Frog   242 KAKLTEIWQRKWDKFIEDLAMNS 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627
adm_rel 25..501 CDD:273620 112/409 (27%)
ADGF 78..493 CDD:238646 108/401 (27%)
ada2XP_017944930.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C26956799
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H81852
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D197912at33208
OrthoFinder 1 1.000 FOG0003139
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.