DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Adgf-C and adal

Sequence 1:NP_650308.3 Gene:Adgf-C FlyBaseID:FBgn0038173 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001096505.1 Gene:adal XenbaseID:XB-GENE-5873451 Length:347 Species:Xenopus tropicalis

Alignment Length:404 Identity:80/405 (20%)
Similarity:142/405 (35%) Gaps:109/405 (27%)


  Fly    79 ALHFFKAKPLIDRSAIFRFLQKMPKGSVLHVHNTASVSSKWVVDDLSYMPGLLRCTTATGQSILS 143
            ||.|::..|.::                ||.|...|:|                  |||.:.:::
 Frog     6 ALQFYRDLPKVE----------------LHAHLNGSIS------------------TATMKKLMA 36

  Fly   144 FRRTPKEH-KCQSQYVLVSDERRNSLDR--QVYDRNFERLINLYTPVPELEYPTITRVWDRFQGM 205
                .|.| ..|....::...::.:|:.  |::     |:|:..|                    
 Frog    37 ----RKPHLDIQHGMTMIDKGQKRTLEECFQMF-----RIIHQIT-------------------- 72

  Fly   206 FDGLSDALIYLPAFRAYHWQMLEELYNDNVMYTEIRTSFKTLYDASGRTFPRE-------RTIHE 263
             |...|.|:...       .:::|...|.|.|.|:|::            ||:       |...|
 Frog    73 -DTAEDILLVTK-------DVIKEFATDGVKYLELRST------------PRDTPAGLTKRAYVE 117

  Fly   264 LYALNQKFMKLHPDFLGFKVIMAVYRGYELDHLKDIVEVFKKLHQALPHFLVGFDLVGQEDKGKP 328
            ......|..|.....:..:.::|:.|.......|:.|::.:....:....::|.||.|....|..
 Frog   118 TVLEGIKQCKEEEVDIDVRFLLAIDRRGGPSAAKETVKLAEDFFCSSNELVLGLDLSGDPTVGHG 182

  Fly   329 LYSLLPVLRDLPPTARLFLHGGETNWFGASTDINLLDALLMNTTRIGHGYALAKHPILLNAVKSR 393
            ...:.|:.:......:|.||..|.......|::    .|.:...|||||..|:....::..||.:
 Frog   183 RDFMEPLNKARQSGLKLALHLSEIPSQAEETEL----LLGLPPDRIGHGTFLSTSDHIVEIVKKQ 243

  Fly   394 RIAVELSPISNQVLHLVWDLRNHPGSQFFALDVPVVICNDDPGFWNAKGLSYDFYYA--IMSLAP 456
            .|.:||...||.....|.....|....::.|..|..:|.||.|.: |..||.::..|  ..:|:|
 Frog   244 HIPLELCITSNIKGQTVSTYNEHHFGFWYNLHHPFALCTDDKGVF-ATDLSVEYEIAAKAFNLSP 307

  Fly   457 NNAGLRLLKTLVWN 470
            ::         ||:
 Frog   308 HH---------VWD 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Adgf-CNP_650308.3 A_deaminase_N 5..98 CDD:285627 4/19 (21%)
adm_rel 25..501 CDD:273620 80/405 (20%)
ADGF 78..493 CDD:238646 80/405 (20%)
adalNP_001096505.1 ADA_AMPD 13..335 CDD:238250 77/398 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.