DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: omd and INTS5

Sequence 1:NP_001262542.1 Gene:omd FlyBaseID:FBgn0038168 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_085131.1 Gene:INTS5 HGNCID:29352 Length:1019 Species:Homo sapiens

Alignment Length:1148 Identity:269/1149 (23%)
Similarity:404/1149 (35%) Gaps:322/1149 (28%)


  Fly     4 QNLLDQLKHFIETVSN--GHSCPQLLTSPNLIKLALGFLEELPATRDIVFEYFALLAEISVQLYV 66
            |.|..::|.|:..|..  ||.    |::....:..|..|..||..|..|.::...:.:.||:.::
Human    29 QELSQEIKAFLTGVDPILGHQ----LSAREHARCGLLLLRSLPPARAAVLDHLRGVFDESVRAHL 89

  Fly    67 S----------PEMADPKTGMPVSQVKLAGNRQQQQRAPEYE-AFNLVKTALQSLVWKGPPAWSP 120
            :          |.:..|    |.|.|...|        |..| ....|:..|...:...|.||:|
Human    90 AALDETPVAGPPHLRPP----PPSHVPAGG--------PGLEDVVQEVQQVLSEFIRANPKAWAP 142

  Fly   121 LIANWSLELVAKLSDKYT---QRRMTITASCN----YWLECSAMHGLMTLINSCFRKLTQPEEEA 178
            :|:.||::|:.:||..|:   ||....|.:.|    .|:.|.|...||.:...|...|.....:|
Human   143 VISAWSIDLMGQLSSTYSGQHQRVPHATGALNELLQLWMGCRATRTLMDIYVQCLSALIGSCPDA 207

  Fly   179 CVEIMLNAFHRFPMTFDWIVARLGGCFPYKIIMQILQCGIKRFVDDYRCH--------------- 228
            ||:.:|:...:....|||:||.:|..||..||.::|.||:|    |:..|               
Human   208 CVDALLDTSVQHSPHFDWVVAHIGSSFPGTIISRVLSCGLK----DFCVHGGAGGGAGSSGGSSS 268

  Fly   229 ----------------------LDSEAGILDYMTSCHEQHLRAAFREMLR---------EGFAPK 262
                                  :.|..|||.::.|.|...:|   ||:||         .|....
Human   269 QTPSTDPFPGSPAIPAEKRVPKIASVVGILGHLASRHGDSIR---RELLRMFHDSLAGGSGGRSG 330

  Fly   263 KPLDVAVVPFLLITTNYSDTILQSLVNVLVEIYTEDMCEVIVQKAPLWLS--NKMFAGM-QPTLN 324
            .|...|.|||||.....|..:|.::...||:..          |.|..||  .:...|. :..|:
Human   331 DPSLQATVPFLLQLAVMSPALLGTVSGELVDCL----------KPPAVLSQLQQHLQGFPREELD 385

  Fly   325 NAVLRLNERGATLLLTAAKMAEKYVWCQDFLDNSMQ----------------------------E 361
            | :|.|    |..|::.|..|..|...|..:|.:|.                            .
Human   386 N-MLNL----AVHLVSQASGAGAYRLLQFLVDTAMPASVITTQGLAVPDTVREACDRLIQLLLLH 445

  Fly   362 LEQWVLNQRNFP--------------------------LLADLAYEETKYMLWKSCLSTNLFEQQ 400
            |::.|.::...|                          |..:....|.|..||          |.
Human   446 LQKLVHHRGGSPGEGVLGPPPPPRLVPFLDALKNHVGELCGETLRLERKRFLW----------QH 500

  Fly   401 TAVRLLLVVSSQHPNIYYQTISQLLKKSYAQNPNGIGALIRLLGGQSGMVNFPGFTP-GFKMVLE 464
            ..:.||.|.:  .|:...:.:..||  |.|::|..:....:|..|.  :|:..|..| .|:..|.
Human   501 QLLGLLSVYT--RPSCGPEALGHLL--SRARSPEELSLATQLYAGL--VVSLSGLLPLAFRSCLA 559

  Fly   465 DI---TLDVQVNNRLPVPPGTPTEAFNTFSNLNILARMHKSKNVAPYIKAQHLNQA----LNECL 522
            .:   ||.         ||.|.    ....||.:|....:.....|.....|..::    |::..
Human   560 RVHAGTLQ---------PPFTA----RFLRNLALLVGWEQQGGEGPAALGAHFGESASAHLSDLA 611

  Fly   523 PKILQIFDCTVNKLVLRIDRDAAERIADKFRAQQSKNSNNNNELCNGKDYGKRTKLEPGEDKVDD 587
            |            |:|..:.:.||..|...            .:|....    ..|.|.:     
Human   612 P------------LLLHPEEEVAEAAASLL------------AICPFPS----EALSPSQ----- 643

  Fly   588 EDATRMRLAHLIVDLLNNIEAGSRTTVLRTPLVLKLATLSVKYFFVGLTEKTVIRRAAASHRSYT 652
                          ||..:.||                  |..||..|........|:|..    
Human   644 --------------LLGLVRAG------------------VHRFFASLRLHGPPGVASACQ---- 672

  Fly   653 LLQRQCSARKIARTVCLRELVERAL------FYHGHLLGQLEVYQLDELEIPEHEHLILQNLHTS 711
            ||.|............|:.|||.||      .:.|.:.|..|...:....:.....|.....||:
Human   673 LLTRLSQTSPAGLKAVLQLLVEGALHRGNTELFGGQVDGDNETLSVVSASLASASLLDTNRRHTA 737

  Fly   712 S--GANSNRSVLHSGIIGRGLRPVLPPSERNCDAEKQALY-----LKALNACC------------ 757
            :  |.....||.|:|:|||||:|......||   :::.:|     |..|..||            
Human   738 AVPGPGGIWSVFHAGVIGRGLKPPKFVQSRN---QQEVIYNTQSLLSLLVHCCSAPGGTECGECW 799

  Fly   758 -ADLEKPNNVEGYSLVSLLLVELVSTDVMYNGLPFPDEEFTRVTMERDMLIRRAFINSPVLWAVL 821
             |.:..|   |....|::.|||.|..|.....|.:|.||..|.|:|||:.|.|.|...|:|:.:|
Human   800 GAPILSP---EAAKAVAVTLVESVCPDAAGAELAWPPEEHARATVERDLRIGRRFREQPLLFELL 861

  Fly   822 GLIAGHRPALCYSSVLLRALCATCLHHWRGKNVNRFQPTAANDELML---CTKKMLQLLAMSQLI 883
            .|:|...|||||.|||||.|.|..|.||....    .|...:....|   ||  ::.::|...|:
Human   862 KLVAAAPPALCYCSVLLRGLLAALLGHWEASR----HPDTTHSPWHLEASCT--LVAVMAEGSLL 920

  Fly   884 PPPLTNLHLIIEHFESAEIALLLRECIWNYLKDHVPSPALF-HVDNNGLHWRNTNTQLAKVPPQY 947
            ||.|.|:|.:.......|:.|||.. :|.:|::|.|.|..| .....|...|:.:.:.......:
Human   921 PPALGNMHEVFSQLAPFEVRLLLLS-VWGFLREHGPLPQKFIFQSERGRFIRDFSREGGGEGGPH 984

  Fly   948 VDPLRHLMQRKLSTLGPHYHQMFIMGELMEGDSE-PDPTARLQ 989
            :..|..::.|.:..||           |..|..: |.|:..|:
Human   985 LAVLHSVLHRNIDRLG-----------LFSGRFQAPSPSTLLR 1016

Known Domains:


GeneSequenceDomainRegion External IDIdentity
omdNP_001262542.1 INTS5_N 4..221 CDD:291503 66/237 (28%)
INTS5_C 229..962 CDD:291504 194/837 (23%)
INTS5NP_085131.1 INTS5_N 29..251 CDD:317271 67/242 (28%)
INTS5_C 290..999 CDD:317272 194/838 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334848158
eggNOG 1 0.900 E1_28HHP
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I3700
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D108880at2759
OrthoFinder 1 1.000 FOG0005538
OrthoInspector 1 1.000 T1074042
orthoMCL 1 0.900 OOG5_135312
Panther 1 1.100 LDO PTHR31697
Phylome 1 0.910 0.947 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4370
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.