DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: omd and ints5

Sequence 1:NP_001262542.1 Gene:omd FlyBaseID:FBgn0038168 Length:994 Species:Drosophila melanogaster
Sequence 2:XP_693062.2 Gene:ints5 ZFINID:ZDB-GENE-090908-2 Length:1023 Species:Danio rerio

Alignment Length:1136 Identity:258/1137 (23%)
Similarity:439/1137 (39%) Gaps:322/1137 (28%)


  Fly     4 QNLLDQLKHFIETVSNGHSCPQLLTSPNLIKLALGFLEELPATRDIVFEYFALLAEISVQLYVSP 68
            |.|..::|.||..|.....  :.|:..:..:.|:..|..:||.|:.|.|:...:.:..|..::..
Zfish    26 QELSLEIKAFISGVDQTQG--RKLSVRDHARCAIRLLRTVPACREAVLEHLRGVYDEYVASFLQD 88

  Fly    69 EMADPKTG---------MPVSQVKLAGNRQQQQRAPEYEAFNLVKTALQSLVWKGPPAWSPLIAN 124
            ..|:.:.|         :.:|.::              :....|...|...:...|.||:||:::
Zfish    89 LEAEGENGGNSASGGASVSISNLE--------------DVIKEVHAVLSEFIKLSPKAWAPLVSS 139

  Fly   125 WSLELVAKLSDKYTQRR-----MTITASCNYWLECSAMHGLMTLINSCFRKLTQPEEEACVEIML 184
            |:::|:.:||.|:..||     .::......|:.|:|...||...:.|...:.....:|||:.:|
Zfish   140 WAVDLLGQLSSKHAGRRAAPHSSSLNELLQLWMSCAATRSLMECYSQCLAAMLAWCPDACVDALL 204

  Fly   185 NAFHRFPMTFDWIVARLGGCFPYKIIMQILQCGIKRFVDDYRCH--------------------- 228
            :...:....|||:||.:|..||..||.::|.||:|    |:..|                     
Zfish   205 DTSVQHSPHFDWVVAHIGSAFPGTIISRVLACGLK----DFYAHGYSSAEKISQQQAIDKSSRVP 265

  Fly   229 -LDSEAGILDYMTSCHEQHLRAAFREMLRE-----------------GFAPKKPLDVAVVPFLLI 275
             :.|..|||.::.|.|...::.....|.::                 |:.....|..|.|||||.
Zfish   266 KIGSVVGILGHLASRHSDSIKKELLRMFQDSLSVPPQNVPQLTSGAGGWENSPHLRRATVPFLLQ 330

  Fly   276 TTNYSDTILQSLVNVLVEIYTEDMCEVIVQKAPLWLSNKMFAGMQPTLNN----AVLRLNER--- 333
            ....|.|:|.::...|||....   .|::|     |..:..|..:..|.|    ||..:::.   
Zfish   331 LAALSPTLLGAVSTELVEFLRP---PVLIQ-----LQAQFQALPREELENMLGLAVHLISQSPSG 387

  Fly   334 GATLLLTAAKMA-------------------EKYVWCQDFLDNSMQELEQWVLNQRN----FPL- 374
            ||.:|...|..|                   |.   |...|...:..|.:.|.|:.:    ||. 
Zfish   388 GARVLKFLADTATPSSVIISGPTPSPHDGIREA---CDRLLQMLLLHLHKLVHNRPDGDEPFPQS 449

  Fly   375 -------------------LADLAYE----ETKYMLWKSCLSTNLFEQQTAVRLLLVVSSQH--P 414
                               :|||..|    |.|..||              :..||.:.|.:  |
Zfish   450 STSPAMPQVIPFLEELQAHIADLCAETLRLERKRHLW--------------LHQLLCLLSVYGGP 500

  Fly   415 NIYYQTISQLLKKSYAQNPNGIGALIRLLGGQSGMVNFPGFTPGFKMVLEDITLDVQVNNRLPVP 479
            :|..:.:.||.  :.|:||                              |::.|..|:..:    
Zfish   501 SIATEALCQLF--TQARNP------------------------------EELALASQLYTQ---- 529

  Fly   480 PGTPTEAFNTFSNLNILARMHKSKNVAPYIKAQHLNQALNECLPKILQIFDCTVNKLVLRID--- 541
                                              |:.:|:..||.       ||.:.|.:|.   
Zfish   530 ----------------------------------LSTSLSGLLPS-------TVARCVAQIHTQT 553

  Fly   542 ---RDAAERIADKFRAQQSKNSNNNNELCNGKDYGKRTKLEPGEDKVDDEDATRMRLAHLIVD-- 601
               ::.|:.:.:...|.||:..       :||:.|..|.......:.......|:.::..:.|  
Zfish   554 LDIKELAQLLNNLATAVQSQEE-------DGKNGGGTTTTTGSLTQSSMASEVRVAVSSNLQDFC 611

  Fly   602 -LLNNIEAGSRTTVLR-----------TPL-VLKLATLSVKYFFVGLTEKTVIRRAAASHRSYT- 652
             ||.:.::|.....:|           :|. :|::...:|.:|||.|.::....:|......|: 
Zfish   612 PLLLHGDSGVSKAAVRLLSCSQIPRACSPAHLLRICRAAVSHFFVCLRQQGKSPQAGQEEVGYSR 676

  Fly   653 -LLQRQCSARKIARTVCLRELVERALFYHGH--LLGQLEVYQLDELEIPEHEHLILQNLHTSSG- 713
             ||.|..:...:::...|::|||.|| :.|:  |.|.|:       |.|..:....|||....| 
Zfish   677 RLLSRLAAYSSLSQKAVLQQLVEGAL-HKGNQDLFGGLQ-------ENPSDDTTQAQNLVPDLGI 733

  Fly   714 --ANSNR-------------SVLHSGIIGRGLRPVLPPSERNCDAEKQAL--YLKALNACC---- 757
              .:.||             ||.|:||||:||:|...|...:.|...|.:  .|..:..||    
Zfish   734 SLLDVNRKFGTSVNFSGNVWSVFHAGIIGKGLKPPYTPLHPDPDRVSQNMQTLLAVMVQCCSSSG 798

  Fly   758 ----------------ADLEKPNNVEGYSLVSLLLVELVSTDVMYNGLPFPDEEFTRVTMERDML 806
                            :|...|.|.|...::::.|||.:..||....|.:|.||.::.|:|||:.
Zfish   799 GNPTGSAGSTCSEPNVSDKLPPINAEAAKVIAVTLVENICPDVANGELSWPPEEHSKTTVERDIH 863

  Fly   807 IRRAFINSPVLWAVLGLIAGHRPALCYSSVLLRALCATCLHHWRGKNVNRFQPTAANDELMLCTK 871
            |||.|..:|||:.:|.::|..||||||.||:||||.:|.|.||....    :|:.::....|.|.
Zfish   864 IRRCFEKNPVLFYLLHVVAAGRPALCYCSVILRALLSTLLAHWESSR----EPSVSDSPWHLQTS 924

  Fly   872 -KMLQLLAMSQLIPPPLTNLHLIIEHFESAEIALLLRECIWNYLKDHVPSPALF-HVDNNGLHWR 934
             .::..:...||:||.|:|::.:..|....|:.|||.. :|.|::.:.|.|..| ...:.||.:|
Zfish   925 CWLVSCMGEGQLLPPVLSNINEVFPHLSPFEVRLLLLG-VWEYMRGNSPMPQKFTFCADQGLFFR 988

  Fly   935 --NTNTQLAKVPPQYVDPLRHLMQRKLSTLG 963
              :.:..:|:    |:.|:..::.:.:..||
Zfish   989 DFSRDGDVAR----YIAPIHSVLHKNIDRLG 1015

Known Domains:


GeneSequenceDomainRegion External IDIdentity
omdNP_001262542.1 INTS5_N 4..221 CDD:291503 56/231 (24%)
INTS5_C 229..962 CDD:291504 198/873 (23%)
ints5XP_693062.2 INTS5_N 26..243 CDD:291503 57/237 (24%)
INTS5_C 266..1014 CDD:291504 198/874 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334847049
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D108880at2759
OrthoFinder 1 1.000 FOG0005538
OrthoInspector 1 1.000 T1053321
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31697
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.