DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: omd and Ints5

Sequence 1:NP_001262542.1 Gene:omd FlyBaseID:FBgn0038168 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_001101046.1 Gene:Ints5 RGDID:1309370 Length:1019 Species:Rattus norvegicus

Alignment Length:1125 Identity:262/1126 (23%)
Similarity:410/1126 (36%) Gaps:279/1126 (25%)


  Fly     4 QNLLDQLKHFIETVSN--GHSCPQLLTSPNLIKLALGFLEELPATRDIVFEYFALLAEISVQLYV 66
            |.|..::|.|:.....  ||.    |::....:.:|..|..||..|..|.::...:.:.||:.::
  Rat    29 QELSQEIKAFLTGADPILGHQ----LSAREHARCSLLLLRSLPPARAAVLDHLRGVFDESVRAHL 89

  Fly    67 -----SPEMADPKTGMPVSQVKLAGNRQQQQRAPEYEAFNLVKTALQSLVWKGPPAWSPLIANWS 126
                 ||....|....|.|....||....:....|      |:..|...:...|.||:|:|:.||
  Rat    90 AALEESPVAGPPHLRPPPSSHVPAGGPGLEDVVHE------VQQVLCEFIRANPKAWAPVISAWS 148

  Fly   127 LELVAKLSDKYT---QRRMTITASCN----YWLECSAMHGLMTLINSCFRKLTQPEEEACVEIML 184
            ::|:.:||..|:   ||....|.|.|    .|:.|.|...||.:...|...|.....:|||:.:|
  Rat   149 IDLMGQLSSTYSGQHQRVPHATGSLNELLQLWMGCRATRTLMDIYVQCLSALIGSCPDACVDALL 213

  Fly   185 NAFHRFPMTFDWIVARLGGCFPYKIIMQILQCGIKRFVDDYRCH--------------------- 228
            :...:....|||:||.:|..||..||.::|.||:|    |:..|                     
  Rat   214 DTSVQHSPHFDWVVAHIGSSFPGTIISRVLSCGLK----DFCVHSGAGGGASACGGSSSQTPSSD 274

  Fly   229 ----------------LDSEAGILDYMTSCHEQHLRAAFREMLR---------EGFAPKKPLDVA 268
                            :.|..|||.::.|.|...:|   ||:||         .|....:|...|
  Rat   275 PFPGSPAIPGEKRVPKIASVVGILGHLASRHGDSIR---RELLRMFHDSLSGGTGGRNGEPSLQA 336

  Fly   269 VVPFLLITTNYSDTILQSLVNVLVEIYTEDMCEVIVQKAPLWLS--NKMFAG-----MQPTLNNA 326
            .|||||.....|..:|.::...||:..          |.|..||  .:...|     :...||.|
  Rat   337 TVPFLLQLAVMSPALLGTVSGELVDCL----------KPPAVLSQLQQHLQGFPREELDNMLNLA 391

  Fly   327 VLRLNERGAT-------LLLTAAKMAEKYVW------------CQDFLDNSMQELEQWVLNQ--- 369
            |..:::...|       .|:..|..|.....            |...:...:..|::.|.::   
  Rat   392 VHLVSQASGTGAYRLLQFLVDTAMPASVITTQGLAVPDTVREACDRLIQLLLLHLQKLVHHRGGS 456

  Fly   370 ------------RNFPLL-------ADLAYE----ETKYMLWKSCLSTNLFEQQTAVRLLLVVSS 411
                        |..|.|       .:|..|    |.|..||          |...:.||.|.: 
  Rat   457 PGEGVLGPPPPPRPVPFLDALRNHVGELCGETLRLERKRFLW----------QHQLLGLLSVYT- 510

  Fly   412 QHPNIYYQTISQLLKKSYAQNPNGIGALIRLLGGQSGMVNFPGFTPGFKMVLEDITLDVQVNNRL 476
             .|:...:.:..||  |.|::|..:....:|..|                      |.|.::..|
  Rat   511 -RPSCGPEALGHLL--SRARSPEELSLATQLYAG----------------------LVVSLSGLL 550

  Fly   477 PVPPGTPTEAFNTFSNLNILARMHKSKNVAPYIKAQHLNQALNECLPKILQIFDCTVNKLVLRID 541
            |:       ||.     :.|||:|......|:......|.|                  |::..:
  Rat   551 PL-------AFR-----SCLARVHAGTLQPPFTARLLRNLA------------------LLVGWE 585

  Fly   542 RDAAE---RIADKFRAQQSKNSNNNNELCNGKDYGKRTKLEPGEDKVDDEDATRMRLAHLIVDLL 603
            :...|   .:..:|....|.:.::...|.          |.| |::|.:..|:.:.:.....:.|
  Rat   586 QQGGEGPSTLGARFGESASAHLSDLAPLL----------LHP-EEEVAEAAASLLAICPFPSEAL 639

  Fly   604 NNIEAGSRTTVLRTPLVLKLATLSVKYFFVGLTEKTVIRRAAASHRSYTLLQRQCSARKIARTVC 668
            :..:            :|.|....|..||..|........|:||.    ||.|............
  Rat   640 SPSQ------------LLGLVRAGVHRFFASLRLHGPPGVASASQ----LLTRLSQTSPAGLKAV 688

  Fly   669 LRELVERAL------FYHGHLLGQLEVYQLDELEIPEHEHLILQNLHTSS--GANSNRSVLHSGI 725
            |:.|||.||      .:.|.:.|..|...:....:.....|.:...||::  |.....||.|:|:
  Rat   689 LQLLVEGALHRGNTELFGGEMDGDNETLSIVSTPLASASLLDINRRHTAAVPGPGGIWSVFHAGV 753

  Fly   726 IGRGLRPVLPPSERNCDAEKQALY-----LKALNACCADLEKPNNVEG-----------YSLVSL 774
            |||||:|......||   .::.:|     :..|..||: ....|..||           ...|::
  Rat   754 IGRGLKPPKIVQSRN---HQEVIYNTQSLVNLLVHCCS-ASGSNEREGCWGAPTLSPEAAKAVAV 814

  Fly   775 LLVELVSTDVMYNGLPFPDEEFTRVTMERDMLIRRAFINSPVLWAVLGLIAGHRPALCYSSVLLR 839
            .|||.|..|.....|.:|.|:..|.|:|||:.|.|.|...|:|:.:|.|:|...|||||.|||||
  Rat   815 TLVESVCPDAAGAELAWPPEDHARATVERDLRIGRRFREQPLLFELLKLVAAAPPALCYCSVLLR 879

  Fly   840 ALCATCLHHWRGKNVNRFQPTAANDELMLCTKKMLQLLAMSQLIPPPLTNLHLIIEHFESAEIAL 904
            .|.|..|.||   ..:|...|..:...:..:..::.::|...|:||.|.|:|.:.......|:.|
  Rat   880 GLLAALLSHW---EASRHPDTTHSPWHLEASCILVAVMAEGSLLPPALGNMHEVFSQLAPFEVRL 941

  Fly   905 LLRECIWNYLKDHVPSPALF-HVDNNGLHWRNTNTQLAKVPPQYVDPLRHLMQRKLSTLGPHYHQ 968
            ||.. :|.:|::|.|.|..| .....|...|:.:.:.......::..|..::.|.:..||     
  Rat   942 LLLS-VWGFLREHGPLPQKFIFQSERGRFIRDFSREGGGEGGPHLSVLHSVLHRNIDRLG----- 1000

  Fly   969 MFIMGELMEGDSEPDPTARL 988
                  |..|..:..|.:.|
  Rat  1001 ------LFSGRFQAPPPSTL 1014

Known Domains:


GeneSequenceDomainRegion External IDIdentity
omdNP_001262542.1 INTS5_N 4..221 CDD:291503 66/231 (29%)
INTS5_C 229..962 CDD:291504 188/822 (23%)
Ints5NP_001101046.1 INTS5_N 29..251 CDD:291503 67/236 (28%)
INTS5_C 290..999 CDD:291504 188/823 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334849384
eggNOG 1 0.900 E1_28HHP
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I3606
OMA 1 1.010
OrthoDB 1 1.010 D108880at2759
OrthoFinder 1 1.000 FOG0005538
OrthoInspector 1 1.000 T1087686
orthoMCL 1 0.900 OOG5_135312
Panther 1 1.100 LDO PTHR31697
Phylome 1 0.910 0.947 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.