DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: omd and ints5

Sequence 1:NP_001262542.1 Gene:omd FlyBaseID:FBgn0038168 Length:994 Species:Drosophila melanogaster
Sequence 2:XP_002943024.1 Gene:ints5 XenbaseID:XB-GENE-6040594 Length:938 Species:Xenopus tropicalis

Alignment Length:1064 Identity:254/1065 (24%)
Similarity:410/1065 (38%) Gaps:262/1065 (25%)


  Fly     9 QLKHFIETV--SNGHSCPQLLTSPNLIKLALGFLEELPATRDIVFEYFALLAEISVQLYVSPEMA 71
            |:|.|:...  .:||.    |:..:..:.:|..|:.||..|..|.|:...:...||..::|..  
 Frog    20 QIKSFLSGTDPQHGHK----LSPRDHARCSLLLLQCLPPARHAVLEHLRTVFHDSVSSFLSER-- 78

  Fly    72 DPKTGMPVSQVKLAGNRQQQQRAPE-------YEAFNLVKTALQSLVWKGPPAWSPLIANWSLEL 129
            |.:..:|.|.       ..|:|.|.       .|....|:..|:..:...|.||:|||:.||:||
 Frog    79 DSQDALPPSS-------SSQRRPPPPPSTQGLDEVTLEVQRVLEEFIKLNPRAWAPLISAWSIEL 136

  Fly   130 VAKLSDKYTQRR-MTITASCN----YWLECSAMHGLMTLINSCFRKLTQPEEEACVEIMLNAFHR 189
            :.:||.|:..|: |..:||.|    .|:.|.|...||.:...|...:.....:|||:.:|:...:
 Frog   137 MGQLSSKHAGRQGMPHSASLNELLQLWMSCGATRVLMDIYTHCLSTMIGSCPDACVDALLDTSVQ 201

  Fly   190 FPMTFDWIVARLGGCFPYKIIMQILQCGIKRFVDDYRCH-------------LDSEAGILDYMTS 241
            ....|||:||.:|..||..||.::|.||:|    |:..|             |.|..|||.:::|
 Frog   202 HSPHFDWVVAHIGNSFPSTIISRVLSCGLK----DFCA
HSSPTDTADKRVPKLGSVVGILGHLSS 262

  Fly   242 CHEQHLRAAFREMLREGFAPKKPLDVAVVPFLL----ITTNYSDTILQSLVNVLVEIYTEDM--- 299
            .|.|.:|.....|..|...|......|.:|:||    ::.:...|:.|.||:.|.......:   
 Frog   263 RHGQSIRQEILRMFHESLRPGSKQQRATLPYLLQLAALSPSLLGTVCQDLVDSLKPATLSQLQQH 327

  Fly   300 CEVIVQK-------------------AP----LWLSNKMFAGMQPT----LNNAVLRLNERGATL 337
            |..:.::                   ||    ..|...|.|.:..|    ::::|....:|...|
 Frog   328 CTTLPREELDNMLNLSVHLACQTSAGAPRLLRFLLDTAMPASVITTPGLAVHDSVREACDRIVRL 392

  Fly   338 LLTAAKMAEKYVW--------------CQDFLDNSMQELEQWVLNQRNFPLLADLAYEETKYMLW 388
            ||.:   .:|.|:              ...||:.....|.:         |.|::...|.|..||
 Frog   393 LLLS---LQKQVYGRPGSRGTSEVQPRAVPFLEAMRGHLPE---------LCAEMLRLERKRHLW 445

  Fly   389 KSCLSTNLFEQQTAVRLLLVVSSQHPNIYYQTISQLLKKSYAQNPNGIGALIRLLG-GQSGMVNF 452
                                        .:|.|..|.  .|:..|....||..||. .||.    
 Frog   446 ----------------------------IHQLIGLLC--IYSSPPCSSEALCILLTLAQSS---- 476

  Fly   453 PGFTPGFKMVLEDITLDVQVNNRLPVPPGTPTEAFNTFSNLNILARMHKSKNVAPYIKAQHLNQA 517
                       |::.|.||::..|.             |::..||:...:::||..    |....
 Frog   477 -----------EELGLAVQLHAVLS-------------SSVQGLAQAAVTRSVAQI----HAGAL 513

  Fly   518 LNECLPKILQ----IFDCTVNKLVLRIDRDAAERIADKFRAQQSKNSNNNNELCNGKDYGK-RTK 577
            .::|..::||    :..|....:...:....:|.::                     |:|: ...
 Frog   514 TDKCALQLLQNLALVVQCEEGSMGREVGMALSEYLS---------------------DFGQLLLH 557

  Fly   578 LEPGEDKVDDEDATRMRLAHLIVDLLNNIEAGSRTTVLRTPLVLKLATLSVKYFFVGLTEKTVIR 642
            .|||             :......||  ......|::  .|..|.:...|..:|   |.....||
 Frog   558 SEPG-------------VCEAACILL--CSCPLPTSI--PPSQLHILIRSSSHF---LFRSMHIR 602

  Fly   643 RAAASHRSYTLLQRQCSARKIARTVCLRELVERALFYH---------------GHLLGQLEVYQL 692
            .::....:..||.|.|......|...|.:|||.||  |               |..||.      
 Frog   603 SSSGVSSASRLLLRLCRVSSAGRKAVLNQLVEGAL--HEGNAGLFGGNRPSSTGPRLGN------ 659

  Fly   693 DELEIPEHEHLILQNLHTSSG---ANSNRSVLHSGIIGRGLRP---VLPPSERNCDAEKQALYLK 751
                  :...|:..|.|..|.   :.|..||.|:|:||.||:|   .....|..|....|:| |.
 Frog   660 ------DTASLLESNSHLGSAVDFSGSVWSVFHAGVIGAGLKPEENSKQLGEEECTENTQSL-LS 717

  Fly   752 ALNACCADLEKPN------NVEGYSLVSLLLVELVSTDVMYNGLPFPDEEFTRVTMERDMLIRRA 810
            .|..|||...:..      :.|....:::.|.|....||..:.|.:|.|:..|.|::||:||.:.
 Frog   718 LLCHCCARKGEDGGQSTTLDPEAAKTLAVTLTENACPDVTNSELAWPPEDHARTTVQRDLLIYKC 782

  Fly   811 FINSPVLWAVLGLIAGHRPALCYSSVLLRALCATCLHHWRGKNVNRFQPTAANDELMLCTKKMLQ 875
            |..:|:|:.:|.|||..||||||.|||||.|.|..|.:|   ..:|.|.:.::...:..:.:::.
 Frog   783 FCQNPLLFQLLHLIAQGRPALCYCSVLLRGLLAVLLAYW---EASRHQDSVSSSWHLKASCELVS 844

  Fly   876 LLAMSQLIPPPLTNLHLIIEHFESAEIALLLRECIWNYLKDHVPSPALF-HVDNNGLHWRNTNTQ 939
            .:...||:||.|||:|.:.......|:.|||.. :|::::::.|.|..| .....|:..|:.:.:
 Frog   845 CMGEGQLLPPALTNMHEMFSLLAPFEVRLLLLS-VWDFIQENGPFPQRFVFQSGRGIFTRDFSRE 908

  Fly   940 LAKVPPQYVDPLRHLMQRKLSTLG 963
              ..|.:|:..:..::.|.:..||
 Frog   909 --GDPAKYMSIVHSVLHRNVDRLG 930

Known Domains:


GeneSequenceDomainRegion External IDIdentity
omdNP_001262542.1 INTS5_N 4..221 CDD:291503 67/226 (30%)
INTS5_C 229..962 CDD:291504 183/815 (22%)
ints5XP_002943024.1 INTS5_N 16..235 CDD:291503 68/232 (29%)
INTS5_C 249..929 CDD:291504 183/816 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334848635
eggNOG 1 0.900 E1_28HHP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D108880at2759
OrthoFinder 1 1.000 FOG0005538
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.